CAZyme Information: MGYG000004003_02776

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02776
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		85930.15	7.5266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 39312; End: 41570 Strand: +

Full Sequence      

MKKPLLLLLCLFTVIGYAKDPHIKAVYALIERVTPGYGKQIKLQLIDPANGEDVYEISSE
KGKVLLKGNNAIALSTAFNQYLKYTCNAHVSWLGNQLNLPENLPLPQKTIRNTINGKYRV
YMNYCTVSYTAAYWDWERWQREIDFMAMNSINMPLATVGLEAVWYNTLLKHRFTDEEARR
FLAGPGHAAWQWMQNLQSYGGPLPKSWIDKHIILAKKIIDRERELGMTPIQQGFSGYVPR
ELKDKYPEAKIRLQPGWCGFKGAGQLDPTDALFATLGRDFLEEEKKLYGTYGIYAADPFH
ESAPPVNTPEYLSAVGHAIYKLIKDFDPKAKWAMQAWSLREPIVKAVPQNDLIILDLNGE
KIKGRKGFWGYPAVEGNLHNFGGRINMHGDLRLLASNQYMTALKQYPNVCGSGLFMEAIE
QNPVYYDLAFEMPLHKGEVAIEEWLKQYANRRYGAVSPSAQQAMICLLEGPYRPGTNGTE
RSSIIAARPALNVKKSGPNAGLGIPYSPLLVIQAEGLLLKDADKLKNSEPYRFDVIDVQR
QMMTNMGQVIHKRAAEAFLNRDKEAFALHSKRFLQMLEDVDELLRTRPEFNFDRWLTSAR
SWGDTEEEKNQLEYDATSLVTIWGADGDPSIFDYSWREWTGLIKGYYLPRWTKFYAMLQE
HLDNGTTYSEEGLRQTHGREAFRANDFYSKLGDWELQFVSTPNKARTPIVQGDEIEIAGR
MYKKYTALAKEYYQDFKADAIKDGKTYENLGE

Enzyme Prediction     

No EC number prediction in MGYG000004003_02776.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	61	724	1.7e-205	0.9969834087481146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.05e-159	119	433	1	330	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	2.53e-80	444	718	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.84e-32	24	104	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT79630.1	0.0	1	752	1	752
QUU09704.1	0.0	1	752	1	752
ASM67128.1	0.0	1	752	1	752
QRP58487.1	0.0	1	752	1	752
QUT48266.1	0.0	1	752	1	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.98e-113	16	665	164	831	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.36e-113	16	665	172	839	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4XWH_A	1.02e-112	25	725	8	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
4A4A_A	2.43e-112	16	665	187	854	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	4.94e-116	25	725	48	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	1.40e-111	25	725	31	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.999070	0.000176	0.000149	0.000146	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_02776.