CAZyme Information: MGYG000004006_01434

Basic Information

• Species: Alistipes sp000434235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp000434235
• CAZyme ID: MGYG000004006_01434
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	MGYG000004006_5|CGC2	56940.81	4.2749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004006	2755781	MAG	United Kingdom	Europe

• Gene Location: Start: 140442; End: 142034 Strand: +

Full Sequence      

MKKIFLIFVLLSFWVAGGYACSGDDPVQGGKEEVDPTPDPDPDPDPDPSGPKEYYVAVDG
KGSGSLADPFGSINAALAVTRPGDVVYVRGGVYSEAVRFTHSGTADAPIVLKAYRDETPV
ISGEGMTWASGPHQLVLISGVDHVTVEGFEVTGLETDDGRLEANGITVSAGATNITLRNN
HVHHIRNTAPQGENIWPGAHGILIIGNTDKAVRNVTVDGNRIHDCETGFSETLTINGFVD
GFTISNNTIYHCSNIAIDAAGGYAANPDPTRNYARNGVICGNVLYGIENSRGELLDGGFG
AIAIYADGSRNITIERNRIFGCDRGIGVVSETDDYPTTDCYVRNNVVYDCWRTGIYMGGY
LNYTTGGSENCYIVNNTLYANNRMEGAFGEIEGEIRLTENCRKITVANNLVCTSRAEDLF
VHKYTATGSDNVFENNYYCGPGAWMWEQQDSNPITDFAAWQATSGGDAEGGYDAVPFFDF
EPTPDADFSIGDAPALKNRGKALPTYFVGTVDFAGNPRTEEGKVSIGAFQ

Enzyme Prediction     

No EC number prediction in MGYG000004006_01434.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	52	417	5.9e-110	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14251	PL-6	1.09e-07	74	437	8	365	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.
pfam13229	Beta_helix	1.14e-06	200	377	1	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.60e-06	239	409	8	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	8.82e-06	136	346	3	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	5.53e-05	303	446	2	147	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE39634.1	3.19e-149	54	530	39	505
QTE60631.1	2.92e-147	54	530	39	505
QTE59904.1	2.92e-147	54	530	39	505
QTE48518.1	2.92e-147	54	530	39	505
QTE41915.1	2.92e-147	54	530	39	505

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94576	3.72e-41	55	495	37	463	Uncharacterized protein YwoF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywoF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005605	0.336644	0.656926	0.000281	0.000248	0.000279

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004006_01434.