CAZyme Information: MGYG000004006_01859

Basic Information

• Species: Alistipes sp000434235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp000434235
• CAZyme ID: MGYG000004006_01859
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535	MGYG000004006_8|CGC2	62394.52	5.7595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004006	2755781	MAG	United Kingdom	Europe

• Gene Location: Start: 62916; End: 64523 Strand: +

Full Sequence      

MKRMIVAAALLGCAAAPAAGQGLTSGPYELPYKNTYVKEVFVAENEYRTARPERIEPLPF
EQARKILPAPVWEGHDREIEMYWHAWRIAVGNIRQPQEGSGFVSPYLDIAYNGNIFMWDM
SFMMMYARYGYRYFPFQRSLDNFYAKQHPDGFICREIRADGSDCFERYDPTSTGPDLLPW
VELAYYRQFGDIERLHRVFPALCAYAKWWRLNRTWPDGTYWSSGWGTGMDNMPRVKPEYN
PIFSHGHMVWLDTNLQQMLVDESLLQIGFYIERWQEIEWLEDEMKHLKRYVNEHLWDEQT
GFLHDRYGDGSLCPTKGIGAYWALQTDALDGERLDRLVAHLSDTTEFARPHRVPSLSADH
AKYNPAGRYWQGGVWPGTNYMLIDGLWRKGYRELAREIAANHYASVFEVWKQTGTFWEYY
APERIEPGFMARKDFVGWTGLPPIALFIEYVLGIKSDYSEQRIEWDITHTEAHGIERYPF
GPDGVVDLKVRRRRSASERPVVTVSTDVPFDLTVMWGDGESRTVRVEKSGEVKFD

Enzyme Prediction     

No EC number prediction in MGYG000004006_01859.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	1.07e-11	117	491	290	634	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	3.24e-08	330	441	364	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	3.11e-07	287	423	614	759	alpha-glucosidase; Provisional
pfam01204	Trehalase	2.14e-04	287	420	341	473	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL07019.1	0.0	1	535	1	535
AFL78925.1	0.0	1	535	3	537
BBK99902.1	0.0	1	535	3	537
BBL10718.1	0.0	1	535	3	537
BBL07927.1	0.0	1	535	3	537

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7T66_A	1.26e-17	192	441	533	806	ChainA, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T66_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	4.69e-25	121	476	63	416	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
O14255	3.89e-17	191	441	524	799	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000737	0.798475	0.199703	0.000376	0.000397	0.000294

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004006_01859.