CAZyme Information: MGYG000004006_02018

Basic Information

• Species: Alistipes sp000434235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp000434235
• CAZyme ID: MGYG000004006_02018
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
879	MGYG000004006_9|CGC1	98741.81	6.273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004006	2755781	MAG	United Kingdom	Europe

• Gene Location: Start: 105765; End: 108404 Strand: -

Full Sequence      

MKKRKQTLCVLLLLIAGGASAAPGDPADLRCEHLTAPLGIDAPAPRLSWRMDDDRQGAAQ
RACRITVGTDSAAVAAGRGGLWDSGRMETDRMLVRYGGAPLQPFTRCYWRITLWDQEGVP
HDSPVAVFETGMMQTGNWQGSWIGDNRDIHYKPAPYFRKEFTAGRNIRSARVYIAAAGLY
ELYLNGERVGDHRLDPLYTRYDRRNLYVTYDVTRQLREGANAVGVLLGNGWYNHQSGAVW
NFERAPWRNRPTFCLDLRIVYDDGSEETVTSGLDWKTSGGPLTFNSIYTSEHYDARLEQP
GWSCPGFDDSAWSGVGYRSAPSQLVTAQQAVPIRQVTRYEPRSVRRLNDTCYLYDFGQNM
AGVTQLRVRGEAGTRLRLIHAERLREDGHADLSNIDVYFRPTDPEDLFQTDVVTLSGRDD
EFMARFNYKGFRYVEVVADRPMELSAANLTAWFQHSDVAPAGKIRSSERLIEQLWEAANK
SYLSNLMGYPTDCPQREKNGWTGDGHLAIETALYNYDAITVYEKWLADHRDEQQPNGVLP
DIIPTGGWGYGTDNGLDWTSTIALIPWNLYLFYGDPAPLEACYENIRRYVDYVDRRSPEG
LTSWGRGDWVPVRSRSSLELTSSVYFFVDASILARAAELFGRSEDHTRYAALAEKIRTAI
NRKYYDPQTGLYANGTQTELSVPLLWGVIPEEEAPRVAANLARRVEEAGCHLDVGVLGAR
AILDALCRNGHAETAYRVAVQTTYPSWGWWIVNGATTLLENWDLEATRDISDNHMMFGEI
GGWFFKALGGIRPDPACPGFRHILLEPHFVGPERFEASHDAPAGRIVSGWERKGSRVTYR
VVIPANCTATLHLPDNVKGPRVYELAAGSHTLTLKLSGR

Enzyme Prediction     

No EC number prediction in MGYG000004006_02018.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	345	853	3.8e-153	0.996031746031746
CBM67	142	315	3.4e-43	0.9204545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.80e-130	461	788	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.89e-77	167	334	3	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	5.22e-26	345	455	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.04e-17	790	859	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10137	PRK10137	1.56e-04	617	701	577	679	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL11635.1	0.0	1	877	1	876
BBL08843.1	0.0	1	877	1	876
BBL00917.1	0.0	1	877	1	876
SCD21043.1	0.0	1	878	2	882
ALJ43909.1	0.0	26	876	28	880

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.73e-170	26	854	32	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.26e-122	32	877	12	1033	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.16e-116	32	870	10	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.36e-122	37	853	43	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.47e-120	32	874	12	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	5.29e-120	8	849	12	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	3.74e-114	32	862	36	888	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999090	0.000173	0.000177	0.000153	0.000141

TMHMM  Annotations     

start	end
7	24