CAZyme Information: MGYG000004006_02138

Basic Information

• Species: Alistipes sp000434235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp000434235
• CAZyme ID: MGYG000004006_02138
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000004006_10|CGC2	31542.67	5.5966

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004006	2755781	MAG	United Kingdom	Europe

• Gene Location: Start: 106149; End: 106994 Strand: -

Full Sequence      

MKRLLTALLLTVAATAATAGGRLETFTLRSEILQSGKSCTVYLPDGYDRDTTRRYPVLYL
LHGASGYHGDWVEKGNMYQIAEEAIAAGRALPMVVVMPDASGTGPHYMGDHMGYFDVPGW
AYERFFFEEFLPAVEQRYRIRGDKRHRAIAGLSMGGGGTAVYALRHPELFSSACPMSALL
ESHGDPEENAFRRSVEENSPVKLVRNLSDEEAAAQRTVRWWVDCGDDDFLALGNIHFFEA
MREKGIPLQYRMRDGGHTWRYWQTVLEEVLTFVSIGFAGEE

Enzyme Prediction     

No EC number prediction in MGYG000004006_02138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	31	273	4.5e-60	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.98e-36	40	281	38	316	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	2.68e-28	41	263	12	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	3.00e-27	41	272	86	294	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4947	COG4947	4.11e-06	121	263	89	220	Esterase/lipase superfamily enzyme [General function prediction only].
TIGR01840	esterase_phb	6.85e-06	41	179	3	129	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO21438.1	9.56e-35	30	268	157	396
QJE30861.1	2.84e-34	21	266	136	380
BBK92061.1	2.84e-34	21	266	136	380
QIX63945.1	2.84e-34	21	266	136	380
QUR47296.1	2.84e-34	21	266	136	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	6.45e-78	22	280	11	275	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	5.29e-29	29	268	138	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	3.87e-24	21	263	30	247	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.04e-23	21	263	30	247	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	7.11e-22	21	268	137	379	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	4.00e-22	21	263	49	266	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	8.47e-20	21	270	429	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	4.84e-17	21	170	498	646	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	7.32e-14	15	263	135	377	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
Q32EQ3	3.88e-09	30	272	21	271	S-formylglutathione hydrolase YeiG OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=yeiG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.998985	0.000177	0.000176	0.000165	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004006_02138.