CAZyme Information: MGYG000004009_00184

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004009_00184
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		45464.43	10.0697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004009	2059820	MAG	United Kingdom	Europe

• Gene Location: Start: 250684; End: 251889 Strand: -

Full Sequence      

MKKSVLALTAVILFMTLLSACSRHTSDETGVIVNGEYRYQGELSNGKYNGYGVLTYKDST
VYSGQWKDGKRHGYGTTTDSLGHTVTALWNCDSIVKGTVSDSTGTYKGELNAKFIPDGHG
TFSGRDGSYYDGAWTNGARNGFGCGIDAKGKAKVGEWKNNKYRGERMTYTAERIYGIDIS
RYQHGRGKKKYAINWSRLRITHLGSISRKKVSGKVDYPVSFIYIKSTEGASVRNPYYLAD
YRQARNHGIPCGAYHFFSTTSQATKQAYYFLRHSRFSRGDFPPVLDVEPTYSQIKKMGGV
SAMFSRIRTWLNIVERRTGVRPILYVSQQFVNKYLPSAPDILKNYQVWIARYGEYKPDVR
LVFWQLCPDGRVNGIHGEVDINVFNGYHDSFRVFLDKNRIK

Enzyme Prediction     

No EC number prediction in MGYG000004009_00184.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	177	375	3.5e-41	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	1.57e-50	175	386	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd00599	GH25_muramidase	2.23e-43	175	384	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06413	GH25_muramidase_1	3.12e-43	174	386	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	7.34e-38	174	386	63	255	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
pfam01183	Glyco_hydro_25	5.23e-36	177	375	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48884.1	3.78e-160	1	400	1	402
QNT67810.1	5.59e-150	101	401	53	353
AGB29361.1	4.17e-147	8	401	21	413
QUB47627.1	2.25e-142	15	395	16	402
BCS86499.1	1.42e-141	46	400	4	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	7.38e-20	174	386	5	204	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
5JIP_A	3.07e-08	221	382	37	220	Crystalstructure of the Clostridium perfringens spore cortex lytic enzyme SleM [Clostridium perfringens],5JIP_B Crystal structure of the Clostridium perfringens spore cortex lytic enzyme SleM [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	8.02e-35	174	396	67	266	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P76421	2.17e-34	174	396	67	266	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	2.17e-34	174	396	67	266	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	1.59e-18	174	386	82	281	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000067	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004009_00184.