CAZyme Information: MGYG000004009_00240

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004009_00240
• CAZy Family: CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
899	MGYG000004009_2|CGC1	105461.57	5.4146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004009	2059820	MAG	United Kingdom	Europe

• Gene Location: Start: 63811; End: 66510 Strand: +

Full Sequence      

MNILLSVIYGTSFGEELVLNLITGVKDGIKLSTPYRMRTVNGHEWTCDLKLDLNKGTYID
YYYSVVRGEDNVIRCEWRNEPHRLEISAVMGDSVRVFDHWIDLPEDSYLYSSAFTDCIRR
RKTSPVALSDYPVTVRFKVRAPQLSATQKLAISGNDEVLGAWDVCKAVPMVEHNFNEWIV
DIDVTKLKSKVMYFKFIAVDVHDNTDVIWESSMNRRVELPSMKEGDVVVYELDEAFFPIY
DVRCAGTQIPVFSLRSKTSFGVGDFGDLKKMIDWVALTQQRVLQLLPINDTTITHTWTDS
YPYSSISIFALHPQYADFTSLPQIEDEKERERFETLRKELNALPQVDYERVNEAKTEYLQ
TLYRQDGSMVLASAEFKKFFENTSSWLVPYAQYCYLREKNGTADFSKWPDHNLFDEAERA
MLSNPRNAAFKNVAFYYYVQFILDRQMSDVHQYARSKGVVLKGDIPIGVNRFGCDVWQEP
RYFNLNGQAGAPPDDFSVNGQNWELPTYNWDEMMKDGCVWWIHRFANMARFFDAYRIDHV
LGFFRIWEIPIDSVHGLLGQFSPALGMTREEIEAYGLHFQEELFTEPFITDWVLDRMFGE
RAAMVRDTYLEPSHDGRYRMKEAYNTQRKIEAAFAGKTDKADTDLRDGLYALVSDVLFVR
DHKDHNKFHPRISVQFDYIYESLYDSDKYLFNKIYNDYFYRRNNQFWYREAMNKLPKIVD
ATRMLVCAEDLGMVPDCVPWVMNELKILSLEMQSMPKDPNVRFGVLSRNPYRSVCTISSH
DTPTLRQWWDEDEKRTQDYFNNVLMKYGAAPHPLPGWLARDIISRHLLCPSMLCIISLQD
WFSIDENLRLADKDRERINVPANPHHYWRYRMHVDLEDLIDRHDFNQNVTDLIKESGRR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	249	894	6.4e-145	0.9898785425101214
CBM20	133	223	1.7e-16	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02950	PLN02950	0.0	2	885	10	905	4-alpha-glucanotransferase
pfam02446	Glyco_hydro_77	0.0	249	875	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN03236	PLN03236	0.0	243	898	60	741	4-alpha-glucanotransferase; Provisional
COG1640	MalQ	1.39e-102	246	899	15	519	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	1.11e-82	250	898	12	496	4-alpha-glucanotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB90764.1	0.0	1	898	1	897
AXV49694.1	0.0	1	898	1	897
AEA21596.1	0.0	1	898	1	897
QUB88367.1	0.0	1	898	1	897
QUI94086.1	0.0	1	898	1	897

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	1.58e-39	242	568	21	336	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	1.12e-31	243	566	5	324	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
1X1N_A	7.84e-31	260	566	41	349	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	1.30e-30	260	566	93	401	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
5CPQ_A	2.62e-24	234	566	58	389	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RXD9	1.31e-180	60	898	79	927	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q69Q02	2.02e-180	9	898	21	921	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
Q9PKU9	6.50e-55	246	547	30	323	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1
Q9Z8L2	3.03e-54	246	547	26	319	4-alpha-glucanotransferase OS=Chlamydia pneumoniae OX=83558 GN=malQ PE=3 SV=1
O34022	2.12e-53	246	895	30	529	4-alpha-glucanotransferase OS=Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC) OX=227941 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999810	0.000244	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004009_00240.