CAZyme Information: MGYG000004009_00306

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004009_00306
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		55370.6	7.5578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004009	2059820	MAG	United Kingdom	Europe

• Gene Location: Start: 9795; End: 11228 Strand: -

Full Sequence      

MKKTKLIFTLAMLLAVTAVNAASKIYKPWSNGRLVVSENNRYIVHENGTPFFWLGNTAWL
LPERLNRDEVEYFLSYERTAGYNVEQIQVLNAIPTFNVYGHAANNAEFDFSKVSKPDVYG
YWEHLDYIVDVAERNGIYIAMDCIWGSQIDAMDTKKAAALGTFLAKRYKDKPNIIWLIGG
DIMGNKKPEIWDAMARAIKKIDKNHLMTFHPRGRTTSAWWFNDREWMDFNMFQSGHRRYG
QRNGDGDYTIKDNTEEDNWRYVDMSFEKKPLRPVIDGEPSYEDIPQGLHDFSAPRWQDYD
VRRYAYWAVFAGAFGHTYGHNSVMQFIRPGLQASFAAEKPWWDAMKDPGYNQMKYLKWLM
LSFPFTDRIADQSIIAGQNGERYDRIIATRGNDYMLVYNYSGKPMSIDLTKISGAKKNVW
WMNPADGSLTYLGEYDNKTTEFTYDAAYLRGSDRVLIAVDSSKNYISKTDKQIPERQ

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	32	456	1.1e-157	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	1.92e-143	39	363	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	1.82e-41	369	458	1	91	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT45348.1	3.54e-240	23	476	24	481
QJR57645.1	1.31e-239	1	475	1	482
ALA76191.1	1.31e-239	1	475	1	482
AII68767.1	1.31e-239	1	475	1	482
QJR61953.1	1.31e-239	1	475	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.60e-234	18	473	2	459	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	2.14e-231	23	475	20	477	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
3KZS_A	1.71e-225	18	473	2	459	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.998977	0.000195	0.000177	0.000168	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004009_00306.