CAZyme Information: MGYG000004009_00868

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004009_00868
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000004009_12|CGC2	36152.03	7.5807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004009	2059820	MAG	United Kingdom	Europe

• Gene Location: Start: 41083; End: 42051 Strand: -

Full Sequence      

MTLLVAFCVLTAAKAASPYDNPDTLVVSRDGTGQFRTINEAVEVCRAFMEYHKVIYVKNG
VYKEKIVIPSWLTNIEICGESVENTIITYDDHANIRLVETNKPMGTFRTYTVKVEGTDIT
FKNITIENNAARLGQAVALHTEGDRLVFVNCRLLGNQDTVYTGVGGTRVYFKDCYIEGTT
DFIFGPSTAWFENCTIHSKQNSYVTAASTPKDVVYGYVFNKCRLTAADGVTKVYLGRPWR
PYAYTVFMNCELGAHIVPAGWHNWNDAANEKTARYFEYNNTGAGAKTTERAPWSRQLTKK
EAAQITLENVFKTETSWIPVVK

Enzyme Prediction     

No EC number prediction in MGYG000004009_00868.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	25	312	3.4e-104	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	1.88e-84	25	304	7	289	pectinesterase
pfam01095	Pectinesterase	4.47e-78	26	306	3	290	Pectinesterase.
PLN02682	PLN02682	5.44e-69	24	302	70	352	pectinesterase family protein
COG4677	PemB	7.31e-68	4	312	59	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	2.82e-65	25	303	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	3.79e-175	3	319	4	322
ADE82952.1	3.79e-175	3	319	4	322
BCS84477.1	9.90e-174	14	319	18	323
AGB28242.1	3.23e-167	3	319	7	323
QJR97878.1	1.10e-166	8	319	2	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	2.31e-45	25	318	9	308	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	7.01e-43	26	293	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.88e-41	25	290	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.02e-40	25	290	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	4.96e-32	28	319	12	342	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.81e-61	27	302	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	2.00e-56	24	318	272	573	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	1.58e-55	24	305	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	3.32e-54	24	318	259	560	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8VYZ3	1.78e-51	24	318	84	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999145	0.000151	0.000155	0.000148	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004009_00868.