CAZyme Information: MGYG000004015_00875

Basic Information

• Species: Psychrobacillus sp012843435
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Psychrobacillus; Psychrobacillus sp012843435
• CAZyme ID: MGYG000004015_00875
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000004015_4|CGC1	39564.78	9.0646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004015	3783055	MAG	United Kingdom	Europe

• Gene Location: Start: 28240; End: 29316 Strand: -

Full Sequence      

MNNNKIVLTGGGTAGHVSLNEAIIPELLRNGYEVHYIGSADGIEKSIIEKSFPTLPYHTI
SNGKLRRYFSIKNFSDPFKVLYGTMQAMRTLRKIKPSLVFSKGGFVSVPVVVAAKLSNIP
VVIHESDITPGLANKIATPFAEHIFTVFEETLKYIPRDKSSAIGAIIRPDLFQGDEKIAR
ELTGFSPFKETIIVMGGSQGSKSINAAIKDNIDTLTKRFQIIHLCGKGNLDPSLIDKPNY
KAFEYVTDELPHLLKITNYVISRAGSNSIFEFLELKKPMLLIPLSKNASRGDQVLNANFF
EKLGYAIVLEEEGLTAETFMNSLSALALNKEKIIDAQCLASSSKTPEQFTELLLTYKN

Enzyme Prediction     

No EC number prediction in MGYG000004015_00875.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	191	340	2.4e-37	0.9426751592356688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	6.93e-140	3	336	1	332	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	2.48e-132	5	333	3	328	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	4.26e-109	5	333	1	328	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.00e-101	5	353	2	348	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	6.25e-87	4	333	1	325	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY19734.1	3.26e-235	1	358	1	358
QGM30272.1	2.68e-234	1	358	1	358
ALC85690.1	8.68e-194	1	357	1	357
QUG41591.1	2.49e-193	1	357	1	357
QFF98923.1	1.27e-180	1	357	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	1.19e-32	5	347	4	342	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.70e-25	5	324	8	320	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	6.14e-25	6	346	12	352	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2V1X5	7.17e-132	5	354	5	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=murG PE=3 SV=1
Q893R7	2.90e-131	5	356	4	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=murG PE=3 SV=2
B2TLE0	1.60e-130	5	354	5	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=murG PE=3 SV=1
C5D4C2	2.62e-129	3	332	2	330	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geobacillus sp. (strain WCH70) OX=471223 GN=murG PE=3 SV=1
A6M1F0	8.59e-126	5	354	5	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004015_00875.