CAZyme Information: MGYG000004017_02733

Basic Information

• Species: HGM11588 sp900754755
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588; HGM11588 sp900754755
• CAZyme ID: MGYG000004017_02733
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		42568.32	6.0671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004017	3620670	MAG	United Kingdom	Europe

• Gene Location: Start: 8312; End: 9421 Strand: -

Full Sequence      

MIGLGKYKVCVYAICKNEAKFARRWMESMREADWVCALDTGSTDGTPELLERLGAIVAEK
TIDPWRFDAARNEAMKLIPPQADICVSTDLDEAFTPGWREALEAAWTDDATQARYRYTWN
FLPDGSEGVVFWPDKIHRNGGFVWKHPVHEILSYQGPLPQKIVTCEGVQLDHRADRSKSR
GQYLPLLELSVREDPDDDRNMHYLGREYFFYGRWKDCVETLKRHLSLPRATWADERCASM
RYIAMALEHLGEMEEAERWFYRAVGEAPYLREPWVNLARFLYQRQDWPGVAYMAHRALQI
QTRPGSYINAAEAWGPLPWDLASIALYHLGQYKESARLAQEALRLAPGDARIQENLRLIR
ARAGEPAEA

Enzyme Prediction     

No EC number prediction in MGYG000004017_02733.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	4.07e-14	8	216	1	221	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	4.27e-08	10	149	1	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	1.60e-07	6	262	2	254	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
sd00006	TPR	1.20e-06	201	299	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	1.57e-06	240	344	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42689.1	2.21e-168	8	356	2	351
QQR04409.1	2.21e-168	8	356	2	351
QIA29496.1	1.27e-167	8	356	2	351
AQS58819.1	1.19e-144	6	362	3	359
AQS58818.1	2.57e-143	4	363	1	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004017_02733.