CAZyme Information: MGYG000004019_00399

Basic Information

• Species: Bacteroides massiliensis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides massiliensis_A
• CAZyme ID: MGYG000004019_00399
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000004019_3|CGC1	87173.29	5.5815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004019	3250001	MAG	United Kingdom	Europe

• Gene Location: Start: 55527; End: 57866 Strand: -

Full Sequence      

MKKNWMLSLVLAANVWSAGAQQVAPAIPRDEKIEQQVESLLQKMTLDEKIGQMCELTIDV
LQDRSGGQDAKDFRLSEAMLDSVFGKYKVGSILNVPQGKAQPVEKWQAVIRRIQEKSMEE
IGIPCIYGVDQIHGTTYTRGGTLFPQGINMGAAFNRELTRREAEISAYETKVGSIPWTYA
PVTDLGRDPRWPRMWENYGEDCYVNAEMGREAVLGFQGNDPNHIGPNHIAACMKHYMGYG
VPVSGKDRTPSSITVQDMREKHFAPYLEMIRNGALSIMVNSAMNNGLPFHANYELLTKWL
KEDLNWDGMIVTDWADINNLYARDHIAKDKKEAIKLAINAGIDMSMDPYSWDFCILLKQL
VQEGEVPMSRIDDAVRRVLRLKYRLNLFEKPYYDLKDYPLFGSDAHAAVALQAAEESLVL
LKNTDNLLPLAKGKKILLTGPNANSMRCLNGGWSYTWQGSNSEDCSESYHTILEAFINKF
GAENIIYEAGVTYNEKGNWWEENAPEIEKAVAAAAQADYIVACIGENSYCETPGNLNDLT
LSANQRHLVQALAKTGKPIILILNEGRPRIIADIEPLARSVVNIMLPGNYGGDALANLLA
GDANFSGKMPYTYPKYPHSLVTYDYKPCEHIGKQMEGAYNYDAVVNVQWAFGFGLSYTTF
IYSNLKVDNTHFTADDVLTFTVDVKNTGNRAGKESVLLFSSDLVASLTPDNRRLRAFEKV
ELQPGETKTVTLKLKASDLAFVGYDGHWVLEAGDFRMQAGNQVLDITCTKTKRWVMPNK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	118	346	1.1e-61	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	9.42e-130	4	760	2	751	beta-glucosidase BglX.
COG1472	BglX	1.58e-72	44	456	1	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.04e-63	45	381	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	5.33e-47	33	767	49	776	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.37e-42	418	657	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42547.1	0.0	1	779	1	779
QUT65958.1	0.0	1	779	1	829
QQA29841.1	0.0	1	779	1	829
QUT61352.1	0.0	1	779	1	829
QUT37180.1	0.0	1	779	1	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	0.0	21	779	1	759	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	1.87e-99	37	766	14	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	9.92e-99	37	766	14	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	5.68e-97	34	776	4	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5TF0_A	8.58e-97	37	769	13	746	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	0.0	3	779	5	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	9.51e-153	37	766	80	818	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
Q56078	5.10e-103	37	760	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	7.41e-102	37	760	38	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	6.48e-97	1	760	1	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000314	0.999029	0.000180	0.000171	0.000151	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004019_00399.