CAZyme Information: MGYG000004019_00702

Basic Information

• Species: Bacteroides massiliensis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides massiliensis_A
• CAZyme ID: MGYG000004019_00702
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	MGYG000004019_5|CGC2	96313.89	4.9928

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004019	3250001	MAG	United Kingdom	Europe

• Gene Location: Start: 73626; End: 76187 Strand: +

Full Sequence      

MKKIKKNLFLLMASLLVCGGLAAQESDFDLDSQRSESQDVNPVPGQALDHHGLLINPTPH
VLRLAEGETLDISHGFRLKGKRSGVADGMDFLTIARKGVTLEIDYGSRQAEKKGVKPVSG
AYELVIDGKGVRITGYDEKGAFYGLQTLRAVLESPVSAGGKMPCLTVNDYPDLPYRGVVE
GFYGTPWSHEVRLSLIDFYGKFKMNYYLYGPKDDPYHSCPNWRLPYPEKEADNIRELVEA
CNRNRVDFVWAIHPGQDIQWNEEDYRNLVNKFNGMYDLGVRSFAIFFDDISGEGTNPYKQ
TELLNRLNEDFVKVNEGVAPLIVCPTDYSRLWANPSPKGSLAIYGNTLDPSINVFWTGDV
VCSDLTRETMEWVNSRIRRPALYWWNFPVTDYARHIVMQGPSYGLDTTLTDKDLCGLISN
PMEHGEASKLVLYSVADYAWNIAGYNALDSWERGLGELAPEVKDAYRTFAIHSCDTETGY
RRAESWETKTFRMDDPYTQADYDALLREFERVERTPAVMEAECRNLLLKNELRPWLVEFG
KLGTRGKKALRLMDLYKTGSAADFWAAYLDNLMTTDDLKAYNVHKAGTMKLQPFYEHAMD
DLLGAFYLREAGKKPATCRAIGSFPTLATTQSKLMFDNDTTTYYTSGTSQDDRSWIGVDL
GLVKPVWEVSILQGRNSTDDVDYFDRALLEYSVDGKAWKALSDTLEKQYVVRWTGDAVQA
RYIRLKKLHTAKTNWAAVRSFEVNPVREERLGFAVESDRKPDALLAFDELPATSFVNEGT
LVFGLPEGTTACTLLVRPGSSARLCQLDARGEVLSETALDTPYMRLNIGKDTSRIRVEGD
VELFEVIFRQEAD

Enzyme Prediction     

No EC number prediction in MGYG000004019_00702.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	176	470	6.1e-104	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	4.77e-165	176	469	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	8.41e-10	120	169	76	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	1.16e-06	112	230	198	316	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	5.66e-06	650	739	31	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.68e-05	651	743	43	141	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62100.1	0.0	5	847	7	852
BBL05673.1	0.0	10	849	8	846
AHF11939.1	0.0	1	847	1	852
ALB75783.1	0.0	16	847	18	850
ADV43394.1	0.0	12	847	11	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	7.87e-153	55	554	16	528	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	1.09e-152	55	554	4	516	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	1.13e-152	55	554	5	517	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2CHO_A	1.13e-152	55	554	5	517	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	1.13e-152	55	554	5	517	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.15e-151	55	554	26	538	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.71e-87	122	520	133	523	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	4.49e-87	122	520	133	523	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	1.46e-51	131	752	143	803	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q8VIJ5	4.36e-33	177	438	63	331	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002198	0.601211	0.395001	0.000719	0.000475	0.000369

TMHMM  Annotations     

start	end
7	24