CAZyme Information: MGYG000004019_02101

Basic Information

• Species: Bacteroides massiliensis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides massiliensis_A
• CAZyme ID: MGYG000004019_02101
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42791.9	6.2846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004019	3250001	MAG	United Kingdom	Europe

• Gene Location: Start: 29792; End: 30922 Strand: +

Full Sequence      

MIKTAFIGVGYRGMQLLRLICHIPGFRVVAVADPGVEYVGMPDVVCYNRSDTDYLNMLAE
QTPRLVFVASPWQCHVQHAMRCVEQGADVALEIKGGLYVDEYRPLIELAARMGRKVYPLE
NTLFMRENLAIYNMVQAGTLGEVVYMRGGYRHDLRRLLLDDDGTLGNRSKTESVWRSRFY
QEENGDLYPTHGLAPLCLIADIGRTDRFKCLTSFASKPAGLRQRIRDLGGPSEVKISLGD
VVVTQLETEKGVLVTLTHDTTLPRPRSLDFEIQGTKGIWQGDRRQIYIEGCSPDEAWESD
EPYIHRYEHSYWKRWGQEALRVDTHHHGMDYVMLKALEADLSGAESYPVDITDLALWTSV
TPWSKLSIAERRTVYL

Enzyme Prediction     

No EC number prediction in MGYG000004019_02101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	372	1.5e-108	0.9448621553884712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.59e-17	1	376	3	340	Predicted dehydrogenase [General function prediction only].
PRK00436	argC	0.008	1	42	2	42	N-acetyl-gamma-glutamyl-phosphate reductase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42950.1	2.86e-210	1	376	9	384
QUT33801.1	3.28e-203	2	376	4	378
QQA30653.1	3.28e-203	2	376	4	378
QUT62197.1	3.28e-203	2	376	4	378
QRO24037.1	6.53e-163	2	376	4	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.85e-82	2	374	21	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.76e-42	2	370	43	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.01e-81	2	374	21	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	6.53e-68	2	370	34	426	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	6.80e-67	2	370	50	442	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	7.14e-67	1	370	52	444	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A3D6B7	1.18e-56	2	371	55	434	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=Sbal_2793 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004019_02101.