CAZyme Information: MGYG000004021_00400

Basic Information

• Species: UBA11471 sp900542765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900542765
• CAZyme ID: MGYG000004021_00400
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	MGYG000004021_2|CGC2	66355.84	6.1107

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004021	2404087	MAG	United Kingdom	Europe

• Gene Location: Start: 189680; End: 191455 Strand: -

Full Sequence      

MKKLALVFSLLILMGGAVAQAQCPPVVQATGASVRPDELTRAYITPVRVVMKYGGRHGDL
LRGDSLLLCPGNGQAQSGRKNCAVMRSTPEEKPFLLLDFGCELHGGLHLVLGGSSRREPS
KVRIRFGESVEEANSETCNSEWKRGFSTDDHTKRDFVMEIPRDGSIELGNTGFRFVRIDL
LEEEATISLKEVSAILRYRDIPYLGSFSCSDERLNRIWATGAYTVHLNMQEFLWDGIKRD
RLVWLGDMHPEMTTITRVFGAHEIVPRSIDLACEQYPLPRWLNNMSAYSMWYLVIMRDWY
QQTGDVDYVRRHADYIAGVVSQVDKKVDEQGNESLASWRFLDWPSSPDTLGVEAGYRALI
IWAMNDASELLTLIGRDNDAALCHDIVFRLEKKSLPHNHLKQAAALMALAGLLDPVQACK
EVVAVGGAERFSTFYGYYMLEALAMAHMYETALDIIRDYWGGMLDMGATTFWEDFNLDWT
VGAAPIDNPVPEGMKDIHGDFGDYCYPGFRHSLCHGWASGPTAWLSDHVLGVSIVDPVKR
WVSIEPHLGDLLWAKGSYPTPWGVIEVSHERLDNGKIKSSVKLPRGVHRVK

Enzyme Prediction     

No EC number prediction in MGYG000004021_00400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	95	587	4e-97	0.9702380952380952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.15e-14	205	478	4	315	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.20e-04	531	587	1	57	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT56828.1	2.04e-303	17	590	19	593
QQY43072.1	5.84e-303	17	590	19	593
QQY39772.1	8.30e-303	17	590	19	593
ABR37902.1	8.30e-303	17	590	19	593
AII64745.1	4.78e-302	17	590	19	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	5.47e-41	88	578	187	682	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	6.51e-14	95	524	95	536	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000519	0.998653	0.000226	0.000221	0.000182	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004021_00400.