CAZyme Information: MGYG000004021_00727

Basic Information

• Species: UBA11471 sp900542765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900542765
• CAZyme ID: MGYG000004021_00727
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		42206.21	6.1896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004021	2404087	MAG	United Kingdom	Europe

• Gene Location: Start: 40968; End: 42062 Strand: +

Full Sequence      

MKKKIFGLIFCFLSMIVSAQTMEELQKLPWKQIATKMPKEWYGTPEAKAIAEKLLLYQSE
LGGFPKNIAFHGEIRQDVIDKIKETGIGTTIDNNATTTEMRFLTNMYAQTHEQIYRDAFF
KALNYIYISQYDNGGWPQFYPYRKGKSVAYSRDITFNDGAIVNVLKLLYAISDDDKPYVI
FNFTPEEKAKALEAYKKGIQCILDTQIRNKKGELTVWCAQHDPETLKPAKARAYELESYS
GDESADIVLLLMKVENPSPEVIAAVKGAVKWFEEHKITDTKYVRYRDENDKWVAYIEYEK
GAKPLWARFYDLETEQPFFCDRDGIKRATLAEVGEERRGGYSWYNDEGNEVLEKYAEWIK
KIGK

Enzyme Prediction     

No EC number prediction in MGYG000004021_00727.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	58	350	5.4e-107	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	4.85e-125	58	352	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	5.42e-110	58	352	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOE21140.1	1.81e-120	29	361	25	356
AKP52260.1	2.46e-114	23	363	32	372
AEL26628.1	1.30e-111	25	363	34	372
QEC53563.1	3.82e-111	18	358	23	365
QUT78007.1	4.56e-107	1	364	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.28e-57	38	361	74	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	1.27e-50	51	363	37	330	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	1.92e-49	51	363	37	330	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000626	0.998475	0.000304	0.000185	0.000194	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004021_00727.