CAZyme Information: MGYG000004021_01109

Basic Information

• Species: UBA11471 sp900542765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900542765
• CAZyme ID: MGYG000004021_01109
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1019	MGYG000004021_10|CGC1	112929.22	4.4217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004021	2404087	MAG	United Kingdom	Europe

• Gene Location: Start: 25902; End: 28961 Strand: +

Full Sequence      

MKKTRLRIKILLSFLLMAAWQPIGAQMPQQEVLNRGVVAVKTSSGVFVSWRYLGTDSPSA
AFNIYRDGEKLNSEPITTSTNYVDAGGTLSSTYVVKRVDYGSETDASEETGVWDTFYKKI
KLQHPPSGVTPPYTVTNSGNEENYPNGQFYSYTPNDCSAGDVDGDGEYEIIVKWDPSNSR
DNSFYGYTGEVYLDCYKMDGTQLWRINLGRNIRAGAHYTQFMVYDLDGDGKAEVACKTAP
GTIDGQGKAVLMGDDTEDLDFRNSRGMVITGTEYLTVFNGETGAEITSVSYDPPRGSVTS
WGGDSYGNRSERYLACIAYLDGLRPSLVMCRGYYERTALAAYNFDGKELTQLWLHDSKSP
GQGAYGQGNHNLSVGDVDQDGCDEIVYGSCAIDQDGTLLYRTGLGHGDAIHLTDFDPDLP
GLELFTPHEESTAKYGMDLHRAGTGEIIFGQYAGKDVGRGGAGDIDPNYRGVEFWTSECG
VRDCKGNSIGGSRPAMNFRIYWDDDLQDELYENTTITKWDPDRKKASTLLELSGYEWTAS
CNSTKATPCLQADLLGDWREEIILWSRNDSASLVIFTTTTPTEYRIPTLMHDHVYRMGIA
WQNVAYNQPPHLSYYIGDGEIEYARLSKISRGEREQTVGIYMPIDTLTFRWDRCDGVELS
GKLPAGISSTYDEASHTISFFGTPTVAGKYTIELSTYGNPVNNPSETITFDIIGEDKITT
VAQYHFDETVGTSAANTVYGQATAEGFTPGWGNGYIGNAIDWSAITAESSRLVQPTYAEL
NTLADQSFTIALWVKGEKANQCLLDIEGDNGSYIRIEGDNLLRFTICDGTNESQLSVRIM
PNLFNNDWNQLICIRDREEGKLNLYLNGERRAQTDDKCGNIEISSITIGNREENGTYLPF
RGMMDELRISTGAMNERQVKEYYNDPTAGINNIEVGNNGMKVYPTHFTHEVQIDFNGDLI
GATTITLCNNAGSVVFEREYHLNGLPRLIIGGFDGLPQGAYILRIANGNSVESYKLFKQ

Enzyme Prediction     

EC	4.2.2.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	29	620	2.6e-259	0.9794168096054888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	31	614	2	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	4.93e-41	29	113	2	86	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
pfam13385	Laminin_G_3	4.82e-15	776	920	5	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
smart00560	LamGL	3.63e-04	786	914	1	130	LamG-like jellyroll fold domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73808.1	0.0	7	1018	3	1026
QCD43243.1	4.80e-268	29	922	18	913
QGT72530.1	6.16e-240	1	619	1	623
BCE14036.1	3.81e-239	24	619	26	599
BCE12411.1	3.81e-239	24	619	26	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	1.05e-238	24	619	5	578	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2Z8R_A	2.57e-235	29	622	4	574	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2ZUY_A	3.16e-219	29	619	7	592	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31526	3.92e-234	29	622	41	611	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31527	1.31e-218	29	619	7	592	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000910	0.983441	0.014949	0.000272	0.000199	0.000190

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004021_01109.