CAZyme Information: MGYG000004021_01222

Basic Information

• Species: UBA11471 sp900542765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900542765
• CAZyme ID: MGYG000004021_01222
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000004021_12|CGC1	41270.57	5.9533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004021	2404087	MAG	United Kingdom	Europe

• Gene Location: Start: 15639; End: 16736 Strand: +

Full Sequence      

MHLFRRLILSGAFCCCAPLFAQTGTPTPSLSGAADGLFYIGAAVEPHQLQGPEGELLKGQ
VNTLTAENAMKMYALWTGDDSAAYRWAAADRIVDFARENGMKVRGHTLIWHNAPAAFFKD
ENGNDLDSAALYRRTEAYMRAVLTHFDSTVFCWDVVNEAIAERDGEGSIYRQDSPWYRIC
GADYIAWAFRTAHRIRPDMKLFYNDYSLVYPDKLQRTLTMLRQLLAEGVPIDGVGMQAHW
NNAVTAEQIQTAVDSFAMLGLDIHITELDLTIYGNYHDGARQATTATLPYDAETSRRQAE
AYARFFEVFRRNSDKISSVTLWGIADNHTWLNNHPVKGRRDYPLLFDTLQQPKVAFFRVI
DTLTE

Enzyme Prediction     

No EC number prediction in MGYG000004021_01222.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	35	361	4.9e-99	0.966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	1.21e-97	33	361	6	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	4.68e-96	70	359	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	2.09e-78	4	363	2	341	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55459.1	7.69e-111	19	361	559	900
QIK60885.1	1.52e-110	19	361	559	900
BAF51703.1	3.67e-93	83	365	12	307
ACY69980.1	5.13e-92	28	361	9	337
QLE02212.1	2.90e-91	28	361	27	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EMC_A	2.62e-83	25	360	2	328	Crystalstructure of XynB, an intracellular xylanase from Paenibacillus barcinonensis [Paenibacillus barcinonensis],3EMQ_A Crystal structure of xilanase XynB from Paenibacillus barcelonensis complexed with an inhibitor [Paenibacillus barcinonensis],3EMZ_A Crystal structure of xylanase XynB from Paenibacillus barcinonensis complexed with a conduramine derivative [Paenibacillus barcinonensis]
4L4O_A	2.85e-83	27	363	10	338	Thecrystal structure of CbXyn10B in native form [Caldicellulosiruptor bescii DSM 6725]
2Q8X_A	3.71e-83	28	360	6	329	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	5.24e-83	28	360	6	329	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
5Y3X_A	1.64e-82	28	361	30	356	Crystalstructure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_B Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_C Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_D Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_E Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL],5Y3X_F Crystal structure of endo-1,4-beta-xylanase from Caldicellulosiruptor owensensis [Caldicellulosiruptor owensensis OL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O69231	1.48e-82	25	360	3	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	1.41e-79	28	361	6	329	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
P23556	1.44e-79	29	360	16	340	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
Q12603	2.19e-75	24	360	29	350	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P40942	1.65e-71	28	361	45	381	Thermostable celloxylanase OS=Thermoclostridium stercorarium OX=1510 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004091	0.528931	0.463605	0.001492	0.001176	0.000681

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004021_01222.