CAZyme Information: MGYG000004021_01847

Basic Information

• Species: UBA11471 sp900542765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471; UBA11471 sp900542765
• CAZyme ID: MGYG000004021_01847
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
287	MGYG000004021_26|CGC1	32472.01	6.681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004021	2404087	MAG	United Kingdom	Europe

• Gene Location: Start: 7607; End: 8470 Strand: -

Full Sequence      

MLFLTCAGIAAVHSQPKSGRIVEDSIYSDVLQDYRRYSVYLPAGYDRSTRDYPVLYLLHG
LSDTHTMWPRRAHLREVMDLLVAGGTVCDMIIISPEAGGNIETAWNGYFDMPGWSYETFF
FTEFLPAVESRYRIVGDKARRAIAGLSMGGGGAVSYAQRHGDKFCAVYAMSALMSIPQRG
MIKPRTPDDKMAILTQSVIDHDCTRYVREAQKSTLDTLRTVSWFVDCGDDDFLLDRNIEF
YQAMRDAGVPCQFRVRDGGHVWEYWHSALYICLPYVSRIFATANTKG

Enzyme Prediction     

No EC number prediction in MGYG000004021_01847.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	28	275	2.2e-54	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.62e-30	36	283	36	315	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.77e-24	28	269	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	4.81e-20	13	269	60	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG0657	Aes	1.96e-08	10	264	39	290	Acetyl esterase/lipase [Lipid transport and metabolism].
COG2819	YbbA	1.44e-07	28	150	16	148	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE30861.1	1.23e-26	19	269	136	380
BBK92061.1	1.23e-26	19	269	136	380
QIX63945.1	1.23e-26	19	269	136	380
QUR47296.1	1.23e-26	19	269	136	380
QEH32729.1	1.38e-26	19	265	147	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	4.55e-131	20	280	11	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
7B5V_A	1.00e-20	19	180	137	305	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	2.57e-20	28	265	139	373	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
4RGY_A	7.53e-18	27	269	10	254	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
1JJF_A	1.88e-17	7	270	18	251	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	7.11e-17	18	164	428	580	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	6.25e-16	7	270	37	270	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	4.67e-11	19	150	498	632	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	9.01e-11	38	263	191	428	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	9.01e-11	38	263	191	428	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000901	0.998224	0.000217	0.000228	0.000202	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004021_01847.