CAZyme Information: MGYG000004022_01574

Basic Information

• Species: HGM13222 sp900757485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; HGM13222; HGM13222 sp900757485
• CAZyme ID: MGYG000004022_01574
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
898	MGYG000004022_11|CGC1	102233.15	4.6146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004022	2646660	MAG	United Kingdom	Europe

• Gene Location: Start: 4098; End: 6794 Strand: -

Full Sequence      

MSEIRGEQENPVTYAGCTVPTFDPEHAVKQTAVSTKDSLQIINDTEFTYSEGWTPYRLTP
RWLGYFNNTNTSSSSAGAWAEYLFSNCESIVLYCAVGKEHGKGLVYLDGGAPVEIDTYRE
DEIGVRKLFDSGLLPEGEHKIRIEVAESEGKTLELDHLEAAGIPAPIRIINNGNSAFFHS
TTGFHREENADSYSGRLLTASDSEEEVSFYFKGSYVRLYGEKAPENGKFEILLDGESKGT
IDCQGSSRQISTLLFEVEGLAEDMFHELRLITPDEHRVAIDYAEIPYNESLMTVMNRRTD
QELARMERHETTATEPKDWKPITLSGKVPEHEVDLHGGVFRQAFQRNIQYLKDSLKKPCW
VDNKDQDRIWVDMLSASNEGRMLGGIGNTLRFAEDEELRQAAEEIIDVIERRQFMNGNGY
MMPYDSNHYKLWQVGWPEIMMDEEKNYDRAMLTKGMLAAGQGGLTQVYPILRKFYDWYNN
AKEYLPYMLLGSMGVQGSIAGPLVYHSPAGIPEDIMTNMKYYDMDWWLEYLAQGLPESIW
RFTLNRPHNYLLTSICAYFEEYTATGEQKYLDACLGAWNIYHQFFHLPGGGISICEHFEC
PPKSHFLTNLPNNIYETCGGVFWIDLNHRFLQLWPERELYAAQMEQSIYNIVLASQGEDG
CIRYFNHMNGRKDIPGRYNTCCEIQATAFFGKLPQYIYMLADDGVYVNLFAGSDIRFEVD
GRPYGIHMNTKFPYTKEVSLHLSAPAGGNMKVRLRIPSWTTGPVEVCINGIVAAAGKPGE
YITLEQEWQDGDRIEFSLPMTFKAERYIGRDRVDGCERYAFSYGPLLMAVRGPLSDNCLQ
AKDEPTIRLSLSAEELLAGLTETDKPLEFSIANEETYRLVPYFSIKDESFTCFPALNQ

Enzyme Prediction     

No EC number prediction in MGYG000004022_01574.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	373	829	2.9e-43	0.8926441351888668

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.48e-41	380	829	61	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.54e-36	323	854	2	518	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH16333.1	0.0	6	898	33	920
QGA23996.1	1.90e-131	314	898	208	806
AXC12824.1	7.09e-129	298	898	230	821
AEN72426.1	1.43e-32	329	829	42	555
BBM71622.1	7.99e-32	329	829	42	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	7.94e-22	377	878	77	614	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.05e-20	377	878	77	614	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	1.08e-18	590	829	312	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
6EX6_A	4.41e-18	565	884	265	610	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.06e-17	590	829	312	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DTR5	2.93e-06	62	282	722	944	A type blood alpha-D-galactosamine galactosaminidase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000027	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004022_01574.