CAZyme Information: MGYG000004022_01722

Basic Information

• Species: HGM13222 sp900757485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; HGM13222; HGM13222 sp900757485
• CAZyme ID: MGYG000004022_01722
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	MGYG000004022_13|CGC1	89527.88	4.7153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004022	2646660	MAG	United Kingdom	Europe

• Gene Location: Start: 28451; End: 30823 Strand: +

Full Sequence      

MALSPYVITPSCKNCFGKAINCYTDNVFEPENILNESSKTTRLAYPAGGVKPRLIIDLGE
ASPGGYPVFRVSAKKGTPVLRIAYADWYDYIVDDIYGEQGDFTRGSCKYLGVELPVLPAN
PNRYELYTICRTGIFSYPLVQGQQRFVMITLDTQDTEVELEYFYIYYTSDLSETAGLFES
TDERLNRLWYASTYTVQIASINNSHSWEAIDGRLALRALTKGNEAGIYKKGLEWTDYTFE
FSGEIACNPDCASGIGWMIRAVNPDNGYLFRLNTDGSLQTFIRKNGINYEQTPRVTLHIP
IFCNMIYRIKTTVEQSNITVYINDTPVLSFADSKYQKGTIGFCQTVEKWAFAHSVKVYHN
TEIYLEDYFKGDLEDYEFTRSKPFLADGAKRDRLPWSGDLDWAGRNAYYAFQDQTYMKET
LFMLARHQLPNGYIWAVCYPEDTCPPADEDYGYYESDIFSAWFVPSLADYLLFTNDCDTA
DKLWNTAAKSLDYLWQYIENDGLFFQRYQTSKGIWDHCLNDIGKFSYTNIIVYHAFADGA
FIANTLGYKEEASRYQTIAEQLKNGILSHLWNKDNYLQKSIKDSSFCFMSNAMALSVGLL
PNELANKAVSACLTHLEDEFIYGKTLASFIRGCFQYQHAEIAYSILTGSTGSIDFLGNCS
VDWISAVLDSKGPATTTECMAYGKQRTSNGLAWSDSSHPDTAVAYLLTGYLLGIQPIFPG
YQTFSFAPYPVGIPHIKGIIPTPFGDIIAEINIQDDKIKADLSYPKGTCPIVQLEKRYQE
HAVIHFSEYE

Enzyme Prediction     

No EC number prediction in MGYG000004022_01722.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	384	769	2.8e-48	0.7182539682539683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.32e-12	387	647	34	290	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	9.57e-08	713	768	1	57	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3387	SGA1	1.03e-07	399	581	283	472	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
COG3408	GDB1	8.34e-07	362	628	245	521	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
TIGR01577	oligosac_amyl	6.35e-04	470	582	365	470	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH42040.1	3.76e-257	6	787	7	776
QJD86808.1	1.13e-240	6	787	15	785
ACU72642.1	2.68e-51	42	747	93	797
ABK06922.1	4.32e-45	31	774	88	833
AMU18509.1	1.47e-37	32	768	90	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.40e-13	381	760	326	685	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004022_01722.