CAZyme Information: MGYG000004030_00736

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS911
• CAZyme ID: MGYG000004030_00736
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		54732.52	5.376

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004030	2505438	MAG	United Kingdom	Europe

• Gene Location: Start: 49975; End: 51453 Strand: +

Full Sequence      

MDDRKINVLYASAEADPLAVCGGLGDVAHALPRALCALGADVRVVMPMYTAIDRRILAGA
EKLIEFTVPLSWRRQHCEVYTLTLGGVFFYLIDNEYYFDRRTVYGCYDDGERFAFFSRAL
VEMIAHIDFKPDILHTNDWHAAAACVYLKKIYCGTRSYSGIRCVHTVHNAEYQGVFGAQT
LDDVFGLESAADVLMQDGCVNLTRGAALLCDRLTCVSQSGRSELLTDAGGAGLGYVFRAC
EDKLYGISNGIDSESFDPATDAELPCRYDASDPGGKFCCKAELQRRLGLPGRCDVPMLAV
ISRLTEQKGMSLLAQALPELLEKDIQLVLLGTGDTEYEMEFRDASFRCHDRLAAVIRFDR
PLSRLIYAGADILIMPSRSEQCGISQMIASRYGTVPLVHSVGGLKDTVSRYDEDSGKGTG
FAFESFDSSAMLDELYRALSLFDYDRTAWNALVGRIMKRDFSWDASAKKYLALYRELTQR
SFLKRKNGKEII

Enzyme Prediction     

No EC number prediction in MGYG000004030_00736.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	7	475	8.5e-160	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02095	glgA	0.0	6	477	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	7	480	2	466	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	7	476	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
COG0297	GlgA	2.12e-162	7	482	2	483	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14098	PRK14098	3.67e-100	1	477	1	486	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY34691.1	5.11e-136	6	481	1	475
AQY50648.1	1.40e-135	6	476	1	474
AXG37973.1	3.19e-134	6	477	1	475
QNO18264.1	1.75e-133	6	477	1	471
QAT49200.1	7.26e-133	6	477	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	2.39e-80	7	474	126	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
6GNE_A	1.07e-73	8	481	12	501	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	9.60e-69	6	477	1	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	6.31e-68	6	477	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	4.77e-67	6	477	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3CM04	9.67e-132	6	477	1	475	Glycogen synthase OS=Streptococcus sanguinis (strain SK36) OX=388919 GN=glgA PE=3 SV=1
A0PY73	2.13e-131	6	480	1	478	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
A8AYH0	8.80e-130	6	477	1	475	Glycogen synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=glgA PE=3 SV=1
C1CEB0	2.57e-129	6	477	1	475	Glycogen synthase OS=Streptococcus pneumoniae (strain JJA) OX=488222 GN=glgA PE=3 SV=1
Q3K1K2	7.05e-129	6	477	1	475	Glycogen synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004030_00736.