CAZyme Information: MGYG000004030_00763

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS911
• CAZyme ID: MGYG000004030_00763
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1026		112783.19	5.2379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004030	2505438	MAG	United Kingdom	Europe

• Gene Location: Start: 11242; End: 14322 Strand: +

Full Sequence      

MNERDSDGREHINKSNSAGIPKRTEKGSDGIEAQLPKRTVQHGENIRQELPKRTVSRSGN
IQSDIPKTSAAANSGTDSVQRTSDRIESTASGLSERKAMIPSDGQRKSAAPGASGLQKKR
IGQNLAGIRAKGKDVRGLYARSESRSSGGQNSGAGRTGKTTDWNKEIRKSARIAGKVCLK
VLSYVMNILLTLMLVGIIAGTIMGCAFLYYINNYVDGSIDNFDMYMSEQDASTSVYYMDW
EDRASGIGTPVEIEDQRLYAKENRMIVSYNDVPKYLIDAYVSTEDHRFWTHNGVDWIRTI
RAAFNYFLGSSSFGGASTITQQVVKNLTEKDDITIQRKVQEIMCALNLEDAKDKTEIMEL
YLNLVYCSRGCYGVQSAAYVYFGKDVSELSLVECVAIGGITQAPTKYDPVSNPENNKQKR
QKMLDNMLHYGNITQQEYDEAYNADLVLNYSKGNSTTSSGSNVFSWYMEAVFDEANELLQ
ETKGLSYLGAQNYIYKGGLQIITAMDPQIQNILEDYYENDANFPRVNNSGVQPESSMVII
DPYSGDVVGLVGGRGRKTQNLIENCATETLRSPGSSIKPISVYAPALEYNVINYGSVIDD
SPVNFGEVTTDASGNKVYSRPDGYPQNYSNTYRGLTNIDYAVTNSLNTVAYKVLDMLTLD
RSFDFVKNKLHMNSLLDGYVTKSGTVLSDKDYSALALGGMNYGVTLLEITAAYQIFPNSG
VYNTPHTVLQIKDKDGNIIVDRGIESEVVISDQTATIMTKLLENVVRRGTASSVTLKNRV
DVAGKTGTTTDDRDRWFVGYTPYYVAGVWFGYKMPQSLSAFSASVPPSAKIWDDVMNKVQ
DIIAQRCTEKGEALKTFVDAPGIIECNYCIDSGKAYGDSCRHDPRGSRVATGYFTLATMP
TDPCDTHVMVEYDGNSGVANSGCKTNKKVALLNIPTRNFPIQVRITDAQYTWRDIGSYDF
CTDPSLPFYAAALTPGTYTGITGGGVQFNRGCPDHGKAEETTVAQTEAATEPQTDDNPPE
TQKPAA

Enzyme Prediction     

No EC number prediction in MGYG000004030_00763.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	260	427	2.8e-59	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	2.32e-174	263	839	1	528	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.03e-145	262	838	74	595	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.44e-126	179	916	2	780	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	5.77e-67	262	428	11	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	1.34e-65	264	837	58	559	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18445.1	2.38e-144	217	846	36	640
QNL43378.1	5.66e-143	207	912	48	714
ALP94484.1	8.32e-141	232	951	79	788
QBB65500.1	1.94e-140	232	951	47	756
QNU66566.1	3.80e-139	254	916	85	728

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	2.72e-66	348	812	3	432	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
7U4H_A	9.29e-66	262	812	38	735	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	1.06e-61	254	902	26	787	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3ZG7_B	1.35e-60	348	812	3	432	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2JE5_A	2.58e-50	264	819	54	614	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TNZ8	3.62e-87	261	924	88	747	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	3.87e-86	261	907	88	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
A7GHV1	1.09e-84	257	950	69	745	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A7FY32	5.67e-84	257	950	69	745	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	5.67e-84	257	950	69	745	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
181	203