CAZyme Information: MGYG000004030_01472

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS911
• CAZyme ID: MGYG000004030_01472
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000004030_22|CGC2	65101.77	4.5856

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004030	2505438	MAG	United Kingdom	Europe

• Gene Location: Start: 18450; End: 20171 Strand: +

Full Sequence      

MNIPRPEYPRPQLVREKWINLNGEWDFEIDNAEVGRAKKFEDRSCLDGKITVPFCPESRL
SGVGNTDYMNCVWYRKDLDIPSDWSGSRILLNFGAVDYEALVFVNGELCASHKGGYTSFS
VDITDKLRGSGNYVTVCAVDHVRSYTQPVGKQSQALYSAVCSYTRTTGIWQTVFAEPVGK
FYIKNIKTVTDIDNCCAELTVSLNSYAVGCRVSAEASFEGRSVGSASVTVNSMSASLHIP
LSEKHLWDVGQGNLYDLRLTVEYGGEVTDSVNSYFGLRSVALTDKKFMLNGRSVFGRWVL
DQGFYPDGIYTAPTDEALKKDIEYSMQLGFNGARLHQKIFEPRYLYWADRLGYLVWGEHA
NWGLDFTDLLNIKNWLPEWMESVERDFSHPSVIGWCPFNETWDMFGRRPSDDIVSLTYSV
TKAMDPTRPVIDTSGHMHVGDITDIYDIHDYEQDVTAFEEHYKPENGSYDPHPDRQCRAG
QPFFVSEYGGIQWAMDDSGWGYGNAPKSEEEFIARYKGLTEALLRDPDCCAFCYTQLYDV
EQEQNGLMTYDRRFKFDPEIFAAINTQKAAVEE

Enzyme Prediction     

No EC number prediction in MGYG000004030_01472.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	511	5.4e-96	0.5518617021276596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.04e-43	8	489	3	510	beta-D-glucuronidase; Provisional
COG3250	LacZ	2.39e-38	16	430	10	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	6.42e-18	50	430	99	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	7.70e-12	21	137	4	132	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK09525	lacZ	1.43e-11	165	430	205	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY74929.1	2.94e-243	2	573	6	582
QOT10821.1	7.82e-243	1	573	4	580
AYB42891.1	1.11e-242	1	573	4	580
ACX67002.1	2.23e-242	1	573	4	580
QOS82722.1	2.23e-242	3	573	4	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	3.74e-81	6	567	27	581	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3K4A_A	5.16e-30	21	448	17	464	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
4JHZ_A	9.19e-30	21	448	17	464	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]
3LPF_A	9.29e-30	21	448	17	464	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPF_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPG_A Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],3LPG_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],5CZK_A Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12],5CZK_B Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12]
6LEM_B	1.64e-29	21	448	13	460	ChainB, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	9.06e-29	21	448	15	462	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
O18835	6.62e-24	8	430	29	478	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
P06760	2.74e-23	8	442	29	487	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
T2KPJ7	6.52e-23	73	428	106	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
O97524	2.04e-22	8	430	29	478	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004030_01472.