CAZyme Information: MGYG000004036_01471

Basic Information

• Species: UMGS1820 sp900545865
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; UMGS1820; UMGS1820 sp900545865
• CAZyme ID: MGYG000004036_01471
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000004036_36|CGC1	54046.57	5.7507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004036	2961055	MAG	United Kingdom	Europe

• Gene Location: Start: 26594; End: 28018 Strand: -

Full Sequence      

MTENIVEKSGFPKGFLWGGAVAANQCEGAYNEGGKGLSVQDVMPHGLKGAVTLNPTSDNL
KLKGIDFYHRYKEDIRLFAELGFKVFRTSIAWSRIFPNGDDEKPNEEGLKFYDDLFDECL
RHGIQPLVTLSHYEPPLALAEKYNGWLSKKMIDFFAKYAETVFERYKDKVKCWLTFNEIN
ALPKAPFMCGAIKTPPNELSEQDIYRAMHNQFVASARAVELCHRIIPDAKIGCMILGVTV
YPLTPNPDDVIAAMLRDRETYQFADIQVLGYYPKYLKNYFERKNIDIDEQPQDAEILKNT
VDFISISYYSSICEAAESTAEKTGGNLSKGYKNPYLKATEWGWQIDPQGLRYTLNKLCER
YRKPIFIVENGLGAEDKLITHDSGEITVDDDYRIEYIRAHLKEVKKAIADGIEVMGYTLW
GCIDIVSASTAEMRKRYGLIYVDRNDDGSGSLERYKKKSFDFYRRVIDTNGGII

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	9	471	1.5e-152	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	6	471	1	474	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	11	473	4	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	6	471	1	474	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	9	471	2	473	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	8	471	1	470	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR96258.1	4.89e-244	11	471	5	466
AGF57566.1	2.82e-243	11	471	5	466
BBF43945.1	3.22e-240	6	471	1	467
BCZ49362.1	1.36e-238	11	471	5	466
AXU54890.1	8.76e-237	9	471	2	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IPL_A	6.00e-212	11	471	20	482	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
6WGD_A	2.56e-199	1	471	1	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	3.16e-173	5	471	2	476	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.03e-166	9	471	5	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	8.64e-166	9	471	5	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	1.55e-227	11	471	7	468	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	4.79e-204	11	471	8	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P26206	3.97e-180	11	471	5	460	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q48409	4.14e-177	11	472	4	460	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	4.76e-175	11	471	4	459	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004036_01471.