CAZyme Information: MGYG000004039_01392

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS2037
• CAZyme ID: MGYG000004039_01392
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000004039_11|CGC1	45518.86	4.1662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004039	2803182	MAG	United Kingdom	Europe

• Gene Location: Start: 34404; End: 35633 Strand: -

Full Sequence      

MFTGNLSIQVTSTLGLIPIKDATIRISNTGTPENTLEVVQTDSSGQSPQLSLDAPDPSYS
EAPESSVQPYSEYNLEITAPGYEPVSVSGTQILAGTDAIQPVEMTPVEVETAPEEDIVIP
EHTLWGEYPPKIPEDEIKPMNETGEIVLSRVVIPEYIVVHDGVPQDRSAPNYYVKYKDYI
KNVVSSEIYATWSENTIYANILVILSFTLNRVYTEWYRNQGYDFTITSSTAYDQKWMYGR
NIYSNISQLVDSIFANFLSRPGVRQPIFTSYCNGTTATCTGLSQWGSKYLGEQGYTPIEI
VRYYYGNDMYINTATSVSGIPSSWPGYDLTIGASGEKVRQLQQQLNRIAQNYPALPTLAV
DGVYGSNTANAVRIFQRIFGLPQTGIVDYPTWYKISEVFVGVSRISEPD

Enzyme Prediction     

No EC number prediction in MGYG000004039_01392.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	2.32e-14	334	395	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	6.20e-11	329	395	39	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	4.85e-08	325	395	117	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	4.90e-07	168	305	106	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam13620	CarboxypepD_reg	0.004	6	104	2	81	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50293.1	2.96e-194	4	407	13	417
QEI32542.1	2.77e-190	4	407	24	428
QHB25032.1	2.77e-190	4	407	24	428
QRT31086.1	4.22e-190	4	407	26	430
QUO33025.1	8.02e-187	4	407	12	416

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000028	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004039_01392.