CAZyme Information: MGYG000004042_01555

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000004042_01555
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		34846.38	7.0956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004042	2392111	MAG	United Kingdom	Europe

• Gene Location: Start: 20313; End: 21248 Strand: +

Full Sequence      

MRVCYHIVHAGYYIAAVVALFVSVVSQEATAQNVNKLYLDYIEKYAPLAQEQQKLHGVPA
SITLAQGLLESRAGMSTLASQGNNHFGIKCHSTWTGATMLRDDDAPDECFRVYNSPSESY
DDHSRFLHGRRYARLFDLEPTDYAGWSHGLRECGYATDPNYGYKLISIIELYKLYTYDIG
GGVIAATDDDAEFILSQLKSSHAVRRFRGLHYVIAVPGDTYASIAAEFNLDAKKLARDND
ATDPKTQIKAWEEVYLQPKLDHAPKKINKVTIGEDESAHSVAQRYGVTMKLIRDLNPKFK
DAPGTTLRLKK

Enzyme Prediction     

No EC number prediction in MGYG000004042_01555.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	46	174	2.2e-33	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	6.71e-34	41	178	46	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.23e-30	40	178	162	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	2.87e-26	33	178	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	8.77e-26	46	174	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	8.65e-17	22	169	132	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12398.1	5.07e-79	17	296	7	282
QDO71591.1	6.95e-78	14	310	6	305
QCQ36508.1	9.27e-77	14	310	9	299
QLK82793.1	9.27e-77	14	310	9	299
AUI45961.1	9.27e-77	14	310	9	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	3.48e-09	41	169	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	4.06e-09	41	169	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5DN5_A	8.67e-09	35	173	3	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.11e-08	35	173	3	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3K3T_A	2.59e-08	41	169	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.84e-14	25	178	38	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9KQ15	1.61e-09	41	173	164	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	8.59e-09	40	175	241	388	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P15931	5.07e-08	26	173	143	298	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P58231	5.22e-07	35	173	149	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999124	0.000153	0.000151	0.000138	0.000134

TMHMM  Annotations     

start	end
7	29