CAZyme Information: MGYG000004043_00154

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004043_00154
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		40699.2	8.1506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004043	2180000	MAG	United Kingdom	Europe

• Gene Location: Start: 16706; End: 17833 Strand: -

Full Sequence      

MRYFVSAGEASGDLHGGALLRALRDADPQASFEFLGGDEMACAAGHAPLIHYRKMAYMGF
AEVLRHLPDVARNLSTARRALETGKFDALILIDYPSFNLKLARRAVELGIPVYYYIAPKV
WAWKEWRVKSIRKLCRKVLSILPFEVEYFRGKGVEVEYVGNPSAEEIAERQRALQPVEEF
LRANSLSGKKPLLAIVPGSRVGELRNNLPVMLEAAARFPGYQPVVAMAPGLDAELYERFA
PGVPRVEGQTFQLMASSAAALVTSGTATLECALLGTPQVVCYRGSGSKAFYNIMKHVLKC
PFVSLPNLIAGCAVVAELLMHHCNADEVSSELKKILPGAEGRGEMLEGYSAVKTALGGSH
AAEKAATTIVADLTS

Enzyme Prediction     

No EC number prediction in MGYG000004043_00154.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	2.4e-107	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.70e-106	1	373	2	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.72e-98	1	371	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.93e-79	4	342	2	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.44e-70	5	371	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.29e-53	1	309	2	286	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	2.81e-136	1	375	1	376
QQR08529.1	1.57e-129	1	366	1	367
ASB37800.1	1.57e-129	1	366	1	367
ANU64105.1	1.57e-129	1	366	1	367
QCP71596.1	4.28e-120	1	356	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.38e-37	7	336	13	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.40e-37	7	336	13	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.13e-74	2	370	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q1INL4	4.26e-63	1	366	2	367	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q74AT9	1.25e-62	2	366	8	373	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	9.47e-62	5	366	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q02AZ6	1.26e-61	2	358	3	357	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004043_00154.