CAZyme Information: MGYG000004043_00303

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004043_00303
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000004043_3|CGC3	36115.66	5.7662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004043	2180000	MAG	United Kingdom	Europe

• Gene Location: Start: 90732; End: 91712 Strand: +

Full Sequence      

MKKILTSLLLLAAFAVSAAEYDFVVAKDGSGDFTSVQEAVNAVPDLCGSYRTRILVKEGR
YEEKLVIPQTKINLSLIGEGEAVITYGDYASKKNRFDQEMGTAGSSSCYIFPVDFYAENI
TFENSAGPVGQAVACYVGGDRTVFKNCRFLGNQDTLYTHSTGRQYYTGCYIEGTVDFIFG
KSTALFDDCVIHCKRAGGYITAPATPQGQRYGYVFTNCKLTADSAAVRCWYSRPWRDYGQ
TVFIRCDVGGHIRPEGWHNWRKPEREKTAFYAEYGCTGPGADTTKRVPWAKVLPSDEGYT
LPEILGGEDNWDPTLLTGEPRAVVYP

Enzyme Prediction     

No EC number prediction in MGYG000004043_00303.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	23	296	1.4e-101	0.9479166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.21e-86	22	308	1	298	Pectinesterase.
PLN02773	PLN02773	2.23e-85	25	297	9	286	pectinesterase
PLN02682	PLN02682	6.65e-76	21	297	69	351	pectinesterase family protein
COG4677	PemB	6.49e-72	6	307	54	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02708	PLN02708	2.69e-69	22	314	242	551	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41759.1	2.20e-134	1	316	2	320
ALJ61265.1	2.54e-133	21	313	284	576
QUT93206.1	2.54e-133	21	313	284	576
QDO69180.1	1.02e-132	21	323	284	586
QUT45771.1	2.04e-132	21	313	284	576

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	4.80e-50	24	307	10	304	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.27e-49	24	307	6	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.71e-38	18	315	1	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	5.37e-33	18	315	1	341	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]
2NTB_A	5.37e-33	18	315	1	341	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.48e-69	25	297	9	286	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	4.75e-60	24	311	83	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q5MFV6	1.62e-58	24	311	278	576	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
O80722	6.37e-57	22	311	276	576	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1
Q8VYZ3	6.73e-57	27	297	90	365	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000235	0.999073	0.000182	0.000163	0.000162	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004043_00303.