CAZyme Information: MGYG000004044_00404

Basic Information

• Species: UMGS1633 sp900553645
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1633; UMGS1633 sp900553645
• CAZyme ID: MGYG000004044_00404
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000004044_12|CGC1	71521.54	5.4149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004044	2665198	MAG	United Kingdom	Europe

• Gene Location: Start: 5917; End: 7836 Strand: +

Full Sequence      

MKHYAIPDVRDVRIEKGLLGDVAAKMIDSVIPYQWEMLNDRVDGAAPSHCVMNFKIAAGE
AEGEYAGFVFQDSDLAKWLEAAAYSLMVKPNADLEKTCDDLIALIGRAQQPDGYLNTYYT
VKEPGKRWTNMRDNHELYCAGHMMEAACAYFEATGKRQLLDIMTRMAYHIDSVIGPEEGK
LHGYPGHEEIELALVRMYHATGDALMLKLARYFINQRGTKPYFFVEEAKRRDSNNYFDQN
DFKQLYWQSHLPVREQAAPEGHSVRAMYLATGMADVARETGDNTLIAACKHLFESTSTRR
MYVTGGVGSSSIGEAFTFDYDLPNDLAYAETCASIALCFFMRAMLQLEPEGRYADVMERA
LYNTCLAGMSLDGRNFFYVNPLEVDPEASHKDKRKEHVLPVRPQWFGCACCPPNLARLTT
SLAKYMFTLGENEIYMNLYAQAEADLKLGDKHVTLKCGTDYPVSGEIVLHPGAGKYALCL
RIPGWAKTYSIKLNGESIDAAVEHGYARIKREFKDGDVIALSLPMQPRRVYANPHVRADI
GKVAIMRGPVVYCLEQVDNGALVEALCLARNAELSEAAQPDKLGGIIEIHAAGKRLVSSS
NALYSDEAPALEDAELTFIPYYTWANRGENEMTVFVREI

Enzyme Prediction     

No EC number prediction in MGYG000004044_00404.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	12	553	6.2e-217	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	6	638	6	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	4.72e-170	11	553	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADH61394.1	5.64e-245	9	638	14	647
AGT32221.1	2.37e-238	30	638	26	639
AGB18348.1	7.22e-238	9	638	10	646
AIQ35294.1	7.47e-236	1	638	1	647
AWO76529.1	1.50e-235	28	638	24	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.36e-234	1	638	1	647	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.04e-226	3	638	3	647	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.03e-170	25	637	16	657	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.46e-170	25	637	16	657	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	4.13e-170	25	637	16	657	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.65e-170	25	637	16	657	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004044_00404.