CAZyme Information: MGYG000004044_00854

Basic Information

• Species: UMGS1633 sp900553645
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1633; UMGS1633 sp900553645
• CAZyme ID: MGYG000004044_00854
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000004044_32|CGC1	38072.32	5.0195

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004044	2665198	MAG	United Kingdom	Europe

• Gene Location: Start: 12664; End: 13668 Strand: +

Full Sequence      

MIDIASLKRGWNLGNTFDAFGGETGWGNPRTTREMIDFVAQAGFDVLRVPVTWKENMGAA
PNYRLNANFLLRVREVIQWGLDAGMTVILNTHHEGEWLKPSTEYLDKIEPRFIALWRQIA
EYFGDMDERLMFEGMNEPRLEGTPNEWFGGDSQVRRAINVLNRLFVETVRATGGNNLTRG
LLITTCGAQVNERGLKDMIVPADDNLILSLHSYCPDDYAFDRLHGRKIFDESVDADIGAM
FDTLVKFAKPLNLPIIMTEYGAVNKKFANGKYNDEDNAKWARAFLSRAKALGIPCVWWDN
GYFDSGDEHFALLDRINLRWYMPKTVEAIIETTK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	23	301	1.4e-80	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.33e-61	23	304	16	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.95e-33	4	331	48	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA38692.1	2.90e-105	4	334	31	364
QPB75692.1	4.42e-105	4	334	77	410
ADU23111.1	4.42e-105	4	334	77	410
AOZ95201.1	8.10e-102	4	334	87	417
AAA26467.1	6.15e-98	4	334	80	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQP_A	1.01e-88	7	331	23	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
4W85_A	1.80e-88	4	330	9	336	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W85_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose [uncultured bacterium],4W87_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W87_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with a xyloglucan oligosaccharide [uncultured bacterium],4W89_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium],4W89_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from metagenomic library, in complex with cellotriose [uncultured bacterium]
6PZ7_A	3.29e-85	4	330	13	334	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
4W86_A	7.45e-85	4	330	9	336	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS [uncultured bacterium],4W86_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with glucose and TRIS [uncultured bacterium]
4W84_A	7.69e-85	4	330	9	336	Crystalstructure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W84_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in the native form [uncultured bacterium],4W88_A Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with a xyloglucan oligosaccharide and TRIS [uncultured bacterium],4W88_B Crystal structure of XEG5A, a GH5 xyloglucan-specific endo-beta-1,4-glucanase from ruminal metagenomic library, in complex with a xyloglucan oligosaccharide and TRIS [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23660	5.81e-106	4	334	31	364	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P54937	9.80e-81	4	334	43	379	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
Q12647	4.87e-80	4	331	29	361	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28623	7.29e-80	4	331	47	370	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P28621	6.94e-78	4	330	46	371	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004044_00854.