CAZyme Information: MGYG000004044_01890

Basic Information

• Species: UMGS1633 sp900553645
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1633; UMGS1633 sp900553645
• CAZyme ID: MGYG000004044_01890
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MGYG000004044_131|CGC1	66539.96	4.9435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004044	2665198	MAG	United Kingdom	Europe

• Gene Location: Start: 1770; End: 3530 Strand: -

Full Sequence      

MFEQKFDDILTAINMPARVQHTAEREGARVKHTFTAEWSADDAMACKTPEMELELSRPII
DIQYQWHSGCGTDRSLKADWCAPTHSKISSGCPLTCFYSDNGTNRLTVALDDCVTLISRQ
MGVREEDATLSIKIKIPLDATGKLESYSVTLWLDETACRYEDAIRAVNAWWEQKYESMPV
PKAARMPMYSCWYSFHQSVYAHEVEAECARAKALGMNTVIVDDGWQTDDNSRGYAYCGDW
QPTPGKIPDMRAHVKAVHDLGMKYMLWYSVPFIGKYSQAARLFDGKTLEYIDSLGAYTLD
PRYPEVRQYLIDTYVRALKEWDLDGFKLDFIDSFRMRPDTPAWREGMDYVVLEDAVRRLM
IDVMNALRAIKDDILIEFRQSYMGPVMREFGNMMRVGDCPNSTSTNRVGMVDLRLTSGNT
AVHSDMLVWNVNDSVECAVDQIENVLFCTVQVSVLLDRVPEKHISALKFWLDFMRRENHL
LTEVPLYAEAPQMLYPQVSAIEDGRGVIAGYLSGYCVKLPASKLRECYVVNANSGTELML
KADSAADWNIDVMDCTGARVRTERVSISGITAINVPAYGLIHMTRE

Enzyme Prediction     

No EC number prediction in MGYG000004044_01890.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.94e-63	184	476	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	6.49e-12	211	377	67	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	7.53e-07	187	358	2	147	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	2.93e-06	176	426	281	528	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	1.20e-05	185	348	1	169	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ22829.1	1.72e-158	49	585	36	575
QUO31288.1	2.09e-158	22	586	19	586
QMV40951.1	4.58e-155	58	586	57	588
QOV11148.1	9.17e-155	49	585	45	587
QWG32884.1	2.01e-153	49	568	44	568

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004044_01890.