CAZyme Information: MGYG000004045_00896

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus
• CAZyme ID: MGYG000004045_00896
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806	MGYG000004045_15|CGC1	92212.64	7.0875

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004045	2286716	MAG	United Kingdom	Europe

• Gene Location: Start: 19758; End: 22178 Strand: -

Full Sequence      

MKEIDFNRNWTLYRSNNDQGKNINLPFDAMINTKRNPDQQTYFLLAGFEGKKCTYKKTLN
IKEEALNQDYLLEFEGIYCDSTVLVNKQEAKKKLYGYTPFTVNLSKYLHVGNNEIEVIVD
VPKENHGRWYTGEGIYRPVHLYVGKNNYLLPQTLQVSTLEINPAKIKSSVSVKGTGILKF
QVLDLDGKLLTETTEHKINSSFNSKEIIIDNAKLWSADDPNLYQLRALLFDDHHKLIDSE
STEFGIREIKIVPNKGLFVNGKHVFLKGGCIHNDNGVIGVVNNEATEFHRAKILKESGFN
AIRSSHHPMARSLMKACDHVGLYVMDEAFDYWYRLKGLNPYNQEFLQHFKGDVKAMVQDA
YNHPSVLMYSIGNEIPEAGSLKGVRVGEAIIDEIHKYDRSRLTILSPSVHWLTSYLRDTP
YLNMTEDEFIKRSPDNKKKDFNHYLKIFMSAAANIPNSNNKNNYPDKQIKEDEDATNRLY
EKLDLAGYNYYGDKYETLHKLHPDRLIVGTETRAGFIVDRMHFARKHPYVIGNFVWTLQD
HLGEVNCSEMHKLNEEVYRGYPWLTNYCGVIDLIGNISPEIHRFEFSWNPHKHGIYLASQ
VPSSNKEKVEFNDYKWSTGIENWSYPGLEGKPTWIDVYTDAYKVKLYLNDKLVGISKPKD
YYACLPVNYEPGTLTAIGVDENEKELYRTSLVTAGTKLKITANADRTILKANGNDFAFIK
ISVTDKDGNVVRCPEHKIKANISGPATLAGFGSSNPMNEVAFNLEEQKTYLGQLMLVIRT
TSEKGKIIINLQSDNDLSQKVELLSE

Enzyme Prediction     

No EC number prediction in MGYG000004045_00896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	593	8.8e-86	0.6143617021276596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.17e-55	1	407	10	440	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	2.27e-33	55	401	69	443	beta-D-glucuronidase; Provisional
PRK09525	lacZ	7.31e-30	104	374	174	462	beta-galactosidase.
PRK10340	ebgA	1.80e-26	55	374	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	7.46e-25	700	802	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK92219.1	4.52e-144	1	787	1	773
CBL26977.1	4.25e-140	1	794	1	801
AEE97750.1	3.37e-139	1	778	1	758
QZN73691.1	1.63e-138	1	803	1	815
QRT50826.1	2.24e-138	1	803	1	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	5.18e-98	1	789	5	761	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.50e-97	1	789	5	761	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	2.94e-81	1	805	1	801	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	3.19e-77	2	790	8	792	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	3.51e-75	4	793	28	808	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	4.61e-71	5	794	46	837	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.36e-57	55	758	110	772	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	4.54e-38	5	761	55	788	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.29e-35	55	793	60	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q9K9C6	3.49e-27	54	374	123	460	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004045_00896.