CAZyme Information: MGYG000004045_01250

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus
• CAZyme ID: MGYG000004045_01250
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000004045_25|CGC1	27234.24	10.1351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004045	2286716	MAG	United Kingdom	Europe

• Gene Location: Start: 14244; End: 14951 Strand: -

Full Sequence      

MKRYHHKYTLPAIITLLLLAIAFLFVGFFNFKKQTTLPPNSNSSAIGIQLNQDVDYVDLH
KLQANGISFVYLKSTQGRSYFDENYLSYRDQILGTKLAFGSMILYSNESTPLQHYRYFFE
KVGDNTGSLPILLEPAVNSRSKRYLTSMGQFASMLEQRNKSVIVDVDYKYHKYFTPQTKF
MSVDKKVPNKLKYSFWRYTTNGRVKNVNGLEKGVTMYAYNGTVGQYRQKYGQLTQ

Enzyme Prediction     

No EC number prediction in MGYG000004045_01250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	55	205	2.2e-20	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06419	GH25_muramidase_2	2.69e-64	38	206	1	178	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	1.56e-11	47	209	2	179	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06413	GH25_muramidase_1	1.89e-09	57	221	15	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	2.17e-05	51	207	7	180	Glycosyl hydrolases family 25.
COG3757	Acm	2.64e-05	28	209	44	246	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ06790.1	1.89e-161	1	235	1	235
ADQ58616.1	1.89e-161	1	235	1	235
ATO53632.1	1.89e-161	1	235	1	235
AEA31583.1	1.89e-161	1	235	1	235
AAV42495.1	2.61e-145	1	235	1	234

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000001	0.000037	0.000002	0.000000	0.000000	0.000005

TMHMM  Annotations     

start	end
7	29