CAZyme Information: MGYG000004045_01723

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus
• CAZyme ID: MGYG000004045_01723
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000004045_47|CGC1	55979.58	5.0022

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004045	2286716	MAG	United Kingdom	Europe

• Gene Location: Start: 9517; End: 10998 Strand: -

Full Sequence      

MAFDNKFTWGGATAANQYEGGYDEGGKGLNAIDVLTNGSATEPRKVTWKKPNGETGATPL
IWGQDFSLPESAVPALLDGYYYPSHQGTDFYHHYKEDIKLMAEMGFDVFRLSMNWSRILP
NGDDEKPNEEGLAFYDKVFDECAKYGIEPLVTLSHYETPLSLITRFGGWKDRRLIDAFVH
YSDIVMNHYKGKVRYWLTFNEINAMDMAPYMGGGLIDGSEQNRAQGAHNQFVASAKVVKL
AHEIDPNNRVGQMLAYSAYYPYTCDPKDQLKVMEVKQDMLFYSDVQTGGRYPDYRLKKYE
RDGIKLDDTPEDYELIAKYPADFLSFSCYTSNVLTTHEADAKASGNVTAGGVKNPYLESN
AWGWATDPDVLRIALNDLWDRYHKPLWVVENGLGSADTLEKDGSVHDDYRINYLRSQIKS
MRDAVTIDGVDLMGYTTWSAIDLVSNGTGEMKKRYGFVYVDRDDRGHGSLKRYPKDSFYW
YKKVIKSNGEDLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	489	1.7e-142	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	3	493	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	493	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	493	4	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	1	492	2	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	4.73e-167	7	492	10	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDD70540.1	0.0	1	493	1	493
ATO53878.1	0.0	1	493	1	493
ADQ58896.1	0.0	1	493	1	493
ADZ07046.1	0.0	1	493	1	493
AEA31845.1	0.0	1	493	1	493

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	8.36e-176	3	492	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	3.47e-170	6	492	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	9.87e-170	6	492	10	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	9.78e-165	6	492	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
2XHY_A	1.07e-158	1	492	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.72e-167	3	492	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	4.09e-167	3	493	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	9.02e-161	1	493	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	1.79e-159	7	492	8	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	5.84e-158	1	492	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004045_01723.