CAZyme Information: MGYG000004046_00332

Basic Information

• Species: Limosilactobacillus vaginalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus vaginalis
• CAZyme ID: MGYG000004046_00332
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000004046_4|CGC2	27477.85	10.3515

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004046	1731903	MAG	United Kingdom	Europe

• Gene Location: Start: 49618; End: 50319 Strand: -

Full Sequence      

MTIPKKIHYIWFGGEKNEIAKRAIETWKKRAPKYQIVEWNEYNLPNYKNKFYQAALKNKD
YAFASDYARLEILKKYGGVYMDTDMYLLKDPSKILKDKELVFSIQDRNVIISTSFIAAQA
NQTFIKEALKIYDTVSYRKGFNKPNTELLSPLIFRLYGFKNEDRVQLKGRVVAFGSDVLL
QPTFRAVAMHIGEKSWESHSRHDNMRILLRKHIQNRLEAGIFSFFNNIGRRIF

Enzyme Prediction     

No EC number prediction in MGYG000004046_00332.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	96	1.4e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.64e-16	2	132	81	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	8.91e-14	21	95	5	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.00e-11	3	132	46	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	9.74e-06	5	168	1	146	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	6.76e-04	60	85	169	194	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX57718.1	2.05e-104	3	232	2	231
AYJ41438.1	2.87e-36	3	223	2	226
QXE01065.1	1.04e-33	3	198	2	213
CED94668.1	2.44e-33	1	228	1	234
APP11889.1	3.61e-33	3	222	2	224

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004046_00332.