CAZyme Information: MGYG000004046_01106

Basic Information

• Species: Limosilactobacillus vaginalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus vaginalis
• CAZyme ID: MGYG000004046_01106
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		23919.84	5.6841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004046	1731903	MAG	United Kingdom	Europe

• Gene Location: Start: 21707; End: 22402 Strand: -

Full Sequence      

MNKLSKNIAKVTAAVAGVVALGTIATTTTANADSIYTVQSGDTLSGISYKLGHDLTFVDT
LASNNNIANKNLIYVGQKLVIKDDGEVAPATQEQVETLPSANTANQTSSAAASTSAASQS
QAQSQQTASASTQAQTATATTSASNAASYSNYTSSVSGNDAAAKAWIAARESGGSYSAQN
GQYIGKYQLSASYLNGDYSAANQERVADQYVASRYGSWSAAQSFWQSHGWY

Enzyme Prediction     

No EC number prediction in MGYG000004046_01106.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	2.48e-10	35	81	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	4.21e-09	36	82	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	1.22e-08	35	81	1	44	Lysin motif.
PRK11198	PRK11198	6.07e-04	36	81	98	145	LysM domain/BON superfamily protein; Provisional
PRK13914	PRK13914	0.001	34	101	200	263	invasion associated endopeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFS34553.1	4.66e-128	1	231	1	231
QFS34549.1	1.96e-112	3	231	2	217
QLQ61502.1	5.33e-106	3	231	2	230
QLL76419.1	5.33e-106	3	231	2	230
AEI56540.1	4.36e-105	3	231	2	230

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GHI8	2.46e-08	35	109	176	243	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=lytN PE=3 SV=2
Q5HGI5	1.10e-07	35	109	176	243	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain COL) OX=93062 GN=lytN PE=3 SV=1
Q6G9W6	1.10e-07	35	109	176	243	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=lytN PE=3 SV=2
Q7A123	1.10e-07	35	109	176	243	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain MW2) OX=196620 GN=lytN PE=3 SV=2
Q7A5Y8	1.10e-07	35	109	176	243	Probable cell wall hydrolase LytN OS=Staphylococcus aureus (strain N315) OX=158879 GN=lytN PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000261	0.999039	0.000166	0.000192	0.000173	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004046_01106.