CAZyme Information: MGYG000004046_01670

Basic Information

• Species: Limosilactobacillus vaginalis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus vaginalis
• CAZyme ID: MGYG000004046_01670
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000004046_58|CGC1	39377.27	9.7534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004046	1731903	MAG	United Kingdom	Europe

• Gene Location: Start: 4754; End: 5809 Strand: +

Full Sequence      

MNDKVILGTVVMLVSLNTALPALASQQDDARNAAEVAVINQEVVDAQVLRSHGDEYTREF
LLQFHNATQKYRQAFQLGVADQEEGRTHAFGDHVEQAAYQRGIEKAKAQTQEKTGAKENT
FSDQLVDQKRYLPKQPLPNQARFINQIADDARQIGKNYDLYPSIIIAQAALESNWGTSDL
SLAPHHNLFGVKGKYNGRGVLKPTTEFVGFQSTQVQDVFRSYTSIKQSLQDYAKTLQQPL
YREVHRSVAKSYREATRALVGCYATDPDYDKKLNQIIDSYQLTRYDDPKKDGNTQSQIIN
SRQYKMPRRSHLRTPHHQTSPKHKKFSPVVSVIGGAASAGALTGLKKLLVS

Enzyme Prediction     

No EC number prediction in MGYG000004046_01670.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	148	282	2.6e-31	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.53e-55	139	299	42	201	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.47e-51	143	289	323	475	amidase domain-containing protein.
PRK06347	PRK06347	2.67e-40	95	301	103	318	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	1.10e-29	143	286	11	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	3.13e-23	148	282	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFS34532.1	7.39e-233	1	351	1	351
QZN92542.1	1.40e-74	1	347	1	359
QFV01117.1	2.35e-74	1	349	3	380
AXX74928.1	7.36e-67	1	349	8	338
QWS03586.1	2.36e-65	1	349	8	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	8.96e-38	140	286	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.29e-33	142	287	62	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.46e-12	143	277	6	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.31e-12	143	277	6	145	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	3.04e-11	143	282	4	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RHZ5	5.07e-34	120	294	42	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	9.71e-34	120	294	42	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	2.65e-33	120	296	42	224	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P37710	4.79e-33	136	300	176	347	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q2G222	6.95e-32	142	287	322	473	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999015	0.000179	0.000185	0.000167	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004046_01670.