CAZyme Information: MGYG000004050_00910

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000004050_00910
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218		23904.64	4.4379

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004050	2129816	MAG	United Kingdom	Europe

• Gene Location: Start: 34970; End: 35626 Strand: -

Full Sequence      

MTIVNDGPNGDGCDPESCRNVLIEDCVFDTGDDCIAIKSGRNEDGRKWNVPSENIIVRNC
TMADGHGGVVIGSEISGGFRNLYVENCRMSSPNLDRVIRIKTSTARGGLIENIYVRNVEV
GQCREAVLRINLNYEPNEQARRGFYPEVRNVLLENVHCSSSEYGVWLYGLDDRTNISGVC
LKNCNFEGVSTGGNYVHGLVGDVELEGCTINGEEFGSL

Enzyme Prediction     

EC	3.2.1.67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	2	192	9.2e-49	0.5323076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.79e-42	5	119	282	394	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	2.32e-15	5	191	133	308	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	5.31e-10	8	196	186	367	Probable polygalacturonase At3g15720
PLN02218	PLN02218	1.27e-09	1	188	233	410	polygalacturonase ADPG
PLN02793	PLN02793	2.09e-08	8	118	225	325	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37152.1	9.03e-101	1	215	253	466
QRQ55855.1	1.50e-99	1	213	255	466
SCV08465.1	1.50e-99	1	213	255	466
ALJ49049.1	1.50e-99	1	213	255	466
CBK68277.1	1.58e-99	1	213	245	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.31e-41	1	218	229	439	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	6.05e-33	7	127	245	364	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	2.18e-10	6	155	376	531	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	2.54e-25	5	134	67	196	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	3.50e-22	8	183	247	421	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	2.11e-12	9	137	372	497	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P05117	8.60e-12	8	190	246	419	Polygalacturonase-2 OS=Solanum lycopersicum OX=4081 GN=PG2 PE=1 SV=1
Q9LW07	2.88e-11	8	196	186	367	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004050_00910.