CAZyme Information: MGYG000004053_00143

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000004053_00143
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	MGYG000004053_2|CGC1	39999.34	9.6242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004053	2223892	MAG	United Kingdom	Europe

• Gene Location: Start: 64846; End: 65892 Strand: -

Full Sequence      

MGIRIHGHPLIWDIRIFHIPTWLLESCLTDPQERDVFMRDIITKLPEFGVRPKPEVYTEK
YQKLTGKDLSKMFPVLSANLKKAFEKRIIEIAEYYGDTVDSWDVVNEAVQAYKQGGFKDG
DKLMKSRFGVIMPADFVFDAFQTAQKHFPKKVKLNINDYLMGKDYRNMIEEMLSRGCKID
IVGSQMHIFNPKSIEDVAAGKTSERMRPDGIRNIMNGIDVGKPIHLSEITITATGNDERG
RMIQAIIARNLYRTWFSIKPMMGITWWNVVDGCGMAGEPSLSGLFTRGMNPKPAFFALDE
LINHEWRTNLSAKPDSDGNIKFRGFKGKYRLSWFDKDGREQFKIVNVK

Enzyme Prediction     

No EC number prediction in MGYG000004053_00143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	2	298	9.3e-37	0.7524752475247525

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	4.17e-29	80	298	58	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	4.08e-28	78	298	98	308	Glycosyl hydrolase family 10.
COG3693	XynA	1.15e-22	2	303	95	342	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA28189.1	2.11e-114	2	348	167	504
QQZ02681.1	1.98e-107	2	341	164	488
AVM47074.1	9.68e-107	2	348	157	496
AHF92621.1	2.10e-101	2	340	157	483
AWI10666.1	4.60e-100	2	348	144	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CPL_A	2.88e-13	80	220	124	260	XylanaseR from Bacillus sp. TAR-1 [Bacillus sp. TAR1]
7CPK_A	2.88e-13	80	220	124	260	XylanaseR from Bacillus sp. TAR-1 [Bacillus sp. TAR1]
6LPS_A	1.21e-12	80	220	123	259	ChainA, Beta-xylanase [Halalkalibacterium halodurans]
2UWF_A	2.23e-12	80	220	122	258	ChainA, ALKALINE ACTIVE ENDOXYLANASE [Halalkalibacterium halodurans]
1NQ6_A	1.70e-11	74	298	94	298	CrystalStructure of the catalytic domain of xylanase A from Streptomyces halstedii JM8 [Streptomyces halstedii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07528	1.86e-12	80	220	168	304	Endo-1,4-beta-xylanase A OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=xynA PE=1 SV=1
P40942	4.77e-08	80	298	158	379	Thermostable celloxylanase OS=Thermoclostridium stercorarium OX=1510 GN=xynB PE=1 SV=1
P07986	2.39e-07	81	271	142	318	Exoglucanase/xylanase OS=Cellulomonas fimi OX=1708 GN=cex PE=1 SV=1
Q60041	1.01e-06	64	305	116	342	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
P14768	2.62e-06	77	303	361	609	Endo-1,4-beta-xylanase A OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=xynA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004053_00143.