CAZyme Information: MGYG000004053_01009

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000004053_01009
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		42673.76	8.1348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004053	2223892	MAG	United Kingdom	Europe

• Gene Location: Start: 18556; End: 19722 Strand: -

Full Sequence      

MEDVLSMRSFDFAAPEKGACDVLVIAGEHSGDEQAERMIASALAEKTDLKVCAFGGQALR
RAGAQLLFDMTSFSVVGLFEVLKNYGFFRKLSEAVADWIATHKPRAVCFVDYPGFNLHLA
KMLKERGVSVKGGGTVKLLYYISPQIWAWKAGRRFEMAELLDGLAVIFPFETKCYADTTL
PVSFVGHPFLDESFEPPVRYCAEGEILMLAGSRSIAVSRIFPVMIGALRRMPNERAVAIY
PTAAIEKTIRNVLAENPDVAPRVRVIANESEVVAAKAAMMSSGTMSLACSLQGIPGAIVY
RANPFTYVVGRSLVNIKYLSIANIILDRPAWREFIQFEASPKKLAAYMQGCIGERGLFEG
YAERLKEVLRSPSKMSAAEWLLAKIGDV

Enzyme Prediction     

No EC number prediction in MGYG000004053_01009.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	22	352	4.6e-88	0.9350282485875706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.72e-79	22	379	4	369	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.32e-75	22	383	4	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.76e-65	22	346	1	333	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.22e-51	22	346	8	339	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.30e-48	67	381	42	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATC65221.1	1.96e-134	8	385	6	382
QYY34968.1	3.19e-131	21	381	11	379
AKC82833.1	7.61e-130	10	386	9	384
QYM79894.1	2.38e-123	5	381	1	376
ACB75370.1	2.81e-123	18	385	15	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.52e-32	16	346	3	339	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.52e-32	16	346	3	339	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KC41	9.43e-56	22	356	6	351	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	9.43e-56	22	356	6	351	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
B6J161	9.43e-56	22	356	6	351	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	1.86e-55	22	356	6	351	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	1.86e-55	22	356	6	351	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004053_01009.