CAZyme Information: MGYG000004053_01064

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000004053_01064
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759		84913.93	8.6972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004053	2223892	MAG	United Kingdom	Europe

• Gene Location: Start: 4011; End: 6290 Strand: -

Full Sequence      

MVKKILCLAGLVFAFSNLWGAAKWISADDFSADAPNTWVAFRKDVKLDSVPKSVKVKIGA
DSKYWLWINGELAVFEGGLKRGPNPTDTYYDEIDIAKFLKGGDNKIALLLWYFGKDGFSH
KSSGKSGMFFESADFPQLDSSAQWLSRVHPAFSTAGFPEPNYRLSESSIKFDANRDMDGW
QTSDGFAKKFAFAKSRELGEIGCSPWNKVHKRPIPQWRQVAIHNLEFTTERALVENLGGA
PVNIVRARLPYNMQMTPIITVDDPRGNSVCEIRTDNTYSASDVNIRAEYVTKKGLQTYES
LGWMNGHELVLKLPRCVKVKEIKCRETGYDTVMAGKFSCDDKFYSAFWNKALRTLYVNMR
DTFFDCPDRERAQWWGDTVILSGEGFYTYSPSMHALIRKAILQLAHWQAPDGALHAPIPG
IYTAELPGQMLASIGEYGFWNYYMNTGDIETIREVYPAVRKYLSLWTLDETGLTNYRKAG
WNWGDWGKNRDMRLIFAGWHKLALEAAAKMADALGKPDEAKAYRQTASKVKDGFEKCWNG
TAYRHPEYLDATDDRVQALAVLADIADESKYGKILALFKKQQHASPYMEKYVMEALFKMG
QGEFALERAKKRFANMVADPNYTTLFEGWEKDGFGGGSVNHAWSGGALTVIARNLIGLYP
TEPAWKKFALEPDPVRFKRASIAVPSVAGEIKASFVRDGEKFLLDLTVPNGTSATVKLPA
FCAGKTVLVNGAKMDSKLEGGKPAFDLGAGDYSIVVSAK

Enzyme Prediction     

No EC number prediction in MGYG000004053_01064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	312	718	9.1e-87	0.8273809523809523
CBM67	22	206	3.4e-25	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.52e-29	333	646	2	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.50e-12	657	719	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	5.16e-04	440	558	109	231	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG3408	GDB1	0.002	418	544	321	468	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PRK10137	PRK10137	0.003	508	537	592	621	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT79846.1	2.89e-306	11	755	8	746
QRP59702.1	2.89e-306	11	755	8	746
ASM67368.1	2.99e-306	11	755	9	747
QXU44133.1	6.41e-294	24	730	46	744
QKZ15800.1	1.88e-288	24	754	17	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.37e-13	317	691	284	672	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.76e-08	443	734	820	1151	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.079505	0.917543	0.002046	0.000342	0.000263	0.000275

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004053_01064.