CAZyme Information: MGYG000004053_01535

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312
• CAZyme ID: MGYG000004053_01535
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909		100464.44	8.7947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004053	2223892	MAG	United Kingdom	Europe

• Gene Location: Start: 4199; End: 6928 Strand: +

Full Sequence      

MKCSLSILAVSSVLAFAGVAAADGVAPFKTTVGEFFENPIGRDLSGLSFSWQIPNTGAGA
AQSAYEIDVRKDGKSVWRTGKVESDASVKVPYGGAALKSGEKFTWRVRYWDEKGAVSDWS
KESTFETGLLELSDWKGEWISSPAQCRPLYSLKAWRKGAMRNFEKIGVPPAYFRKSFAAK
KAVKSARLYAASRGIFEFSINGKPVSDTKWGTGWTSYSKRITSDTFDVSALLQNGENTIG
AILADGWYAGRIENRWLERKVKPELLAQLEIEYADGSREIVATDSSWKSSSGAYYYSDIY
DGEYCDANLEPENWDANGFDDSAWQNAATSAINPKIAITPRRNQPIRVCERLAPISVKRM
SAGTYIFDLGQNMVGVPRISVKGVKGRPIKIRYAEMLNKDGTMYTVNYRSAVSTDHYIPA
SNEVETYTPKFTFHGFRYVEISGLDAAWKPDASAVEGLVMHNDMPQTGTFVCSNPKINKL
QQNIVWGQRGNYFSVPTDCPQRDERMGWTGDAQVFIPTAAFNMNVDGFFSKWNQDMRDCQ
EPSGAMAHVVPCGWGSGSAAWGDAAVICPWEIYLAYGDKKSLAENFDMMKKWVDFQKNTS
KDLIRPDSGFGDWLQPSSTFGNDSKNWRGATPRPLIGTAYFARTADIVSKAAKILGKRDE
AKKYADLARDVRVAFVRNFVSPDGSVKGDAQTAYLLPLAFDILPENMRAKVFGKFLKVLK
RDNLYLDTGFVGTPLLAGVLSRFGRSDLAYKIVQNEGYPSWIYSINQGATTMWERWNSFS
HERGFGEASMNSFNHYAYGSIGKWLYANAAGINYDENAVGYKNIIFAPEIGGVGFDYAAA
TFQSPYGKVVSSWSVKGGKCVWNVSVPPNSTGTLVIPAKNVNGVMLNGKPVDSLTQNVAS
GDYKVEFSL

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	357	875	4e-173	0.996031746031746
CBM67	171	329	1.6e-37	0.8522727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.88e-143	465	808	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.57e-58	181	350	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.28e-37	358	461	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.56e-16	818	877	6	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOE19844.1	8.25e-262	27	889	36	893
BBE17666.1	2.32e-259	29	907	17	891
QDT68743.1	1.19e-258	12	877	2	942
ANW95876.1	1.45e-254	32	889	39	891
AZQ59165.1	6.97e-254	27	891	30	889

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.16e-210	34	884	12	1002	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	3.21e-174	34	877	38	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.37e-164	50	879	26	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	3.35e-242	31	889	39	891	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.92e-218	27	878	31	880	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	4.34e-210	34	884	12	1002	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	6.85e-114	38	900	42	930	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KM26	1.17e-07	49	128	493	577	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000461	0.998404	0.000279	0.000318	0.000270	0.000248

TMHMM  Annotations     

start	end
5	27