CAZyme Information: MGYG000004055_01185

Basic Information

• Species: Eubacterium_G sp900548465
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G sp900548465
• CAZyme ID: MGYG000004055_01185
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681		75984.05	9.5049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004055	2465387	MAG	United Kingdom	Europe

• Gene Location: Start: 62575; End: 64620 Strand: +

Full Sequence      

MKRTVKQVITIGVTLSMVMASMGIEFNTKAATNIADTYKVPVASSTGTIGAIMPYTRYDS
EKAELSGTAVFLESSDYGKMKVATQASNQSYVKLRAKGDYAQWKVTTDGSGVTMRYTMPD
TSDGMGQSGSLDVYVNGTYDQTVNLTSYHMWQYFAGGNPSDVNDGGAPLFAFDEVHFKLN
KSLKSGDIIRIVNNDSKNLQYGIDFIEVEKVPDKIEKPENAESVLDYGAIPNDGKDDYAA
FRDCIYVANNLHKDVYIPEGTYHLSKTLTVKAENIKITGAGMWHTNLKFTSDQQYGGGIS
GNDCKNVEFCNMYIDSNLRSRYKENAVYKCFRDVFENCVFHDIWEDHFECGFWFGDYDQN
TGYSDGTKIVNCRIRNNFADGVNFCQGTSNAAVYNCSVRNNGDDGLAMWNNDYYSKDEVG
NIFAYNTIELGWRAGAIAVYGGDGHRIYNNYICDTAMSAGIHLNTVFSGYKFKNTKGIYF
DNNTLIRTGCKEDAWKSKLAAIDLQGEVKNVIFTNNNIYDSQTDAVRNVENRGNIFKDTK
IFSGGTGYTIPAYPAAGIFDPLRLDIKPTATISANKTDDSKGTTVSKNKLKTVVIKKVSK
KGRKVKIKLKKISSVTGYQIQISRNKKFTKKIITKKVNKVSFVISSAKIKKCKKLYVRAR
VYQKNKGTMRTGKWSKTKVVK

Enzyme Prediction     

EC	3.2.1.59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	46	541	6.5e-153	0.7956448911222781

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	2.17e-46	50	208	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
pfam13229	Beta_helix	2.22e-07	364	535	8	151	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam12708	Pectate_lyase_3	1.69e-06	223	417	3	180	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
pfam13229	Beta_helix	5.74e-04	296	416	46	152	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX41685.1	1.25e-193	35	527	185	682
ANR73273.1	6.18e-192	35	566	24	568
QUB45559.1	6.37e-192	35	566	25	569
BBA29482.1	1.94e-190	35	566	24	568
QUB81474.1	5.62e-190	35	566	25	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	3.45e-147	50	527	13	503	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	9.26e-35	48	502	52	474	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	4.84e-24	50	510	14	461	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	4.84e-24	50	510	14	461	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0Q_A	2.67e-23	50	510	14	461	Catalyticdomain of GH87 alpha-1,3-glucanase D1068A in complex with nigerose [Paenibacillus glycanilyticus],6K0U_A Catalytic domain of GH87 alpha-1,3-glucanase D1068A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004414	0.799520	0.195076	0.000422	0.000292	0.000242

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004055_01185.