CAZyme Information: MGYG000004056_00787

Basic Information

• Species: Alistipes_A ihumii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A ihumii
• CAZyme ID: MGYG000004056_00787
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779	MGYG000004056_36|CGC1	87951.49	7.5906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004056	2329828	MAG	United Kingdom	Europe

• Gene Location: Start: 6987; End: 9326 Strand: -

Full Sequence      

MKLKSFLTTLCLSALLWSPDRAAAALPDRAERPWKARWISSGTTPEQPNTWLNYRYTADL
PALPSSVVARIGADSKYWLWVNGRLVVFEGGLKRGPNPQDTYYDEVELAPYLVKGKNTIA
VLLWYFGRPSFSHNDSGKAGLIFDCQTADFDILSDETWKCETNAAYGTCDKPDPNFRLAE
SNIRYDGRKSDDAWYMPSFDDRDMTRAVDNGPAGCRPWNKLVKRPIPLWKIGELRDYASQ
RRSGDSIICTLPYNAQITPYIKLKAHAGDTVKIMSDNYLVYNGGDNYLRCEYIAREGLQS
YENLGWTNGHKIYYVLPKGAEAVELKFRETGYDTEFTGEFECSDPLYNKFWKKALRTLYL
TMRDTYMDCPDRERSQWTGDAVNESGEAFYVLSESAALLTRKWLHDLAGWQKTDGVIYAP
VPSSNWDKELPGQVMASLGFYGLWNYYWYTGDRQTLADVYPAVQRYIALWKKGNKGTMLL
REGGWNWGDWGTDIDIVPLQNCWYYLMLKGMRNTAQILGKKADAKHYAEQMSALKQAFNA
HFWNGSEYRDPQYEDATDDRVHALAVVSGLADRDKYPAILEVFRTQEHASPYMEKYVLEA
MLQMGHGAEGLARHNRRFSKMVEDDRFTTLFEGWGIGAEGFGGGSVNHAWSGGGLTIASQ
YICGIRPLETAYAKIGILPLPAGLDSARTSVLTPVGRVVSSFEYTPYLFALDAELPAGSR
GVIGAPKQGVREIKINGVTVWKNGRAVRNKVARLSAKQPSDQHLSFDVRGGSYRLIAVQ

Enzyme Prediction     

No EC number prediction in MGYG000004056_00787.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	257	723	1.1e-89	0.9623015873015873
CBM67	36	218	1.6e-35	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.75e-40	335	653	1	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	9.34e-08	432	550	336	469	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17390	Bac_rhamnosid_C	4.56e-07	664	720	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	1.70e-06	436	544	85	212	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam08531	Bac_rhamnosid_N	1.56e-04	64	202	3	145	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22734.1	0.0	34	779	32	777
QUT89433.1	1.01e-313	34	773	21	758
ALJ59524.1	1.43e-313	34	773	21	758
AGY53286.1	2.24e-292	30	777	22	772
ASB50049.1	2.56e-266	34	779	23	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	6.62e-31	31	727	142	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3CIH_A	4.26e-22	335	736	299	720	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6GSZ_A	2.09e-13	333	735	425	856	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	4.71e-20	34	754	149	909	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	2.19e-15	77	747	210	931	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000499	0.998650	0.000299	0.000199	0.000180	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004056_00787.