CAZyme Information: MGYG000004056_01014

Basic Information

• Species: Alistipes_A ihumii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A; Alistipes_A ihumii
• CAZyme ID: MGYG000004056_01014
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000004056_51|CGC1	73761.2	5.0807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004056	2329828	MAG	United Kingdom	Europe

• Gene Location: Start: 7442; End: 9436 Strand: +

Full Sequence      

MKPTILLLAGVLMLALCAEGKSSRRVPANDPATLRVHDALSPAPHGAVRIGGYLGEKLDL
CIDNRLMAQDIERLVQPFRDKPDGNWGFRSEFWGKWFTAAMMGYGYAPSAEHRATVDRAV
RELIATQSADGYIGTYPDSCHLGDWDIWGRKYVLLGLLAYYDQTQETAALEAARRVADHL
IAEAGPESGTNIAATGWIGWKGLASCSVLEPIALLYQRTEEKRYLDFARHIVRSWDEPNR
LAPAGLRLIQEAIGETAPWKMSGAPKAYEMMSCFEGLCELYRITAEPLYLEAVQRLVDAL
VRDEIMIAGSGSVAEIWCHGAVRQSEPLYQGMETCVTATWMKLMYQMLRLTGDSRCADRL
ETSLYNALLGAMSPRGEWWAYYSGLMGERVHSHQQFPDVVMSCCVANGPRGLMITPSWAA
MTGPSGVALNLYAPLQAEVATPDGQPLTIDMQTAYPADGRVQIAVGLPKSEAFALRLRIP
QWSERTSLRINGAPYDGYLIPGTYASIERTWKEGDRIELDLDMRARVVDAPSGSGDRAIV
RGPVVLAFDTRLIPRRDGVSEPPMYRYEFDCDADGYIDAMPTESPVPGVAMTFDVPCLDE
AGGRHLLPMCDYASAGNSWQEGNLFRTWIPQPFDFRHLYVNNLDWHTNVTVGVGRPEIPE
LYRK

Enzyme Prediction     

No EC number prediction in MGYG000004056_01014.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	91	546	1.8e-59	0.8931297709923665

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.58e-70	66	547	20	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.71e-55	38	549	7	503	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	3.18e-06	153	322	551	713	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04791	LanC_SerThrkinase	2.57e-05	153	300	91	234	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd04434	LanC_like	0.003	88	321	38	270	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.83e-126	48	631	27	608
SCM56172.1	6.46e-43	100	567	100	573
QWG10444.1	8.28e-43	52	561	47	591
QBG46791.1	2.83e-42	95	561	102	595
AZQ63834.1	7.00e-42	89	561	91	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	4.30e-26	52	560	49	620	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	2.78e-25	95	609	80	621	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	2.87e-25	95	609	80	621	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
6EX6_A	6.30e-25	108	545	87	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
7EXU_A	6.72e-25	95	609	80	621	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.52e-24	95	609	80	621	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000118	0.143844	0.855919	0.000047	0.000050	0.000043

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004056_01014.