CAZyme Information: MGYG000004063_00475

Basic Information

• Species: Oxalobacter sp900760095
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter; Oxalobacter sp900760095
• CAZyme ID: MGYG000004063_00475
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42285.44	9.5266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004063	2013916	MAG	United Kingdom	Europe

• Gene Location: Start: 5652; End: 6794 Strand: -

Full Sequence      

MRSIAMVAGETSGDILGETLLSALRPQLPNTLMHGIGGARMAKYDFVSNWPMEKLAVNGL
FEVLAHYREIRGIRNHLRDHLLAEKPDVFVGIDAPEFNLDLEVSLKKAGIRTVHFVSPSV
WAWRSGRIKKIAEAVSRILVLFPFEEIIYQKAGIPVTCVGHPLAEAIPMRPDMNAARDNL
GLDKDRPVIAIMPGSRMSELKYNSIPFVEAARLLLQRDPDIQFIIPMAGDEQLAFFTRLM
RSARLDDLPLKLMRGQSHAAITAADAVLVASGTATLEVALFKKPMVIAYRLMRATWEIAR
HIVKPPVGLPNILAGEMIVPELLQNAATGKALSDALWFQLTDQTNRNRLQEKFVAMHYSL
LRNTAQTSAQAVLDVMRQND

Enzyme Prediction     

No EC number prediction in MGYG000004063_00475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	4.4e-122	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.84e-163	1	379	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.00e-131	1	378	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.38e-104	4	372	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.98e-101	3	374	7	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	8.31e-39	8	323	233	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ78800.1	2.33e-231	6	379	1	374
ARQ46736.1	2.33e-231	6	379	1	374
QDX32623.1	2.33e-231	6	379	1	374
AEK61176.1	2.61e-177	3	379	9	386
AMP10826.1	2.21e-176	3	378	9	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	9.79e-92	3	375	8	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.38e-91	3	375	8	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47F79	8.82e-122	4	376	7	381	Lipid-A-disaccharide synthase OS=Dechloromonas aromatica (strain RCB) OX=159087 GN=lpxB PE=3 SV=1
Q2SWY5	4.01e-119	4	376	10	382	Lipid-A-disaccharide synthase OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=lpxB PE=3 SV=1
A1K6Q8	3.57e-118	4	373	5	375	Lipid-A-disaccharide synthase OS=Azoarcus sp. (strain BH72) OX=418699 GN=lpxB PE=3 SV=1
Q5NZG2	3.57e-118	4	379	5	381	Lipid-A-disaccharide synthase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=lpxB PE=3 SV=1
Q62JD7	9.20e-118	4	376	10	382	Lipid-A-disaccharide synthase OS=Burkholderia mallei (strain ATCC 23344) OX=243160 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004063_00475.