CAZyme Information: MGYG000004063_00977

Basic Information

• Species: Oxalobacter sp900760095
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter; Oxalobacter sp900760095
• CAZyme ID: MGYG000004063_00977
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		32651.71	10.3933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004063	2013916	MAG	United Kingdom	Europe

• Gene Location: Start: 7793; End: 8677 Strand: +

Full Sequence      

MFHSFFEQFFSFNSKSRTSHLISTVSRKLFITSHPKVWMFFTGLMLVVALFFCFRPELFR
NVHESFPIREAHATSHVATSETASLIGAEIPEKTEEHSKLDELKQKQRVASWISKRYRIA
GKASNLFVTTAYKTAFELGLDPHLILAVMAVESRFNPYAESSVGAQGLMQVMSKVHADKF
EDHGGIQYALDPVVNIKVGSKILKDYVKQKGSIELALKSYVGAAAMSHDGGYGSRVLTEY
RKLKAVASGSHSPSLVQAKSASKRSARQKKAIGPAPLAKQKKEETPIRDSAVLL

Enzyme Prediction     

No EC number prediction in MGYG000004063_00977.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	141	244	1.6e-18	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01464	SLT	1.16e-21	139	220	9	92	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.12e-21	142	241	1	100	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	7.02e-21	132	220	9	102	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.20e-19	116	248	132	263	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd13401	Slt70-like	1.28e-17	135	220	14	104	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ45275.1	3.20e-122	1	294	1	295
QDX33894.1	3.20e-122	1	294	1	295
ARQ77567.1	3.20e-122	1	294	1	295
AMP16053.1	6.19e-64	100	254	113	267
CDG84411.1	6.91e-64	14	253	24	265

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	5.36e-06	122	203	169	256	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27380	1.97e-07	137	230	17	105	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
O31976	9.14e-07	121	220	1416	1511	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	9.14e-07	121	220	1416	1511	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
A8API2	9.45e-07	122	203	188	275	Membrane-bound lytic murein transglycosylase C OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mltC PE=3 SV=2
A6TDX1	4.04e-06	122	203	188	275	Membrane-bound lytic murein transglycosylase C OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999996	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	59