CAZyme Information: MGYG000004063_01163

Basic Information

• Species: Oxalobacter sp900760095
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter; Oxalobacter sp900760095
• CAZyme ID: MGYG000004063_01163
• CAZy Family: GH103
• CAZyme Description: Membrane-bound lytic murein transglycosylase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		42227.73	5.4095

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004063	2013916	MAG	United Kingdom	Europe

• Gene Location: Start: 5625; End: 6743 Strand: +

Full Sequence      

MPTTYRLIHAGIISVFLSLFLSCSIAHSIEGHDQKAFFACPSSQSDTDMTEKPDQSDSFR
KSSADFIHELSEKHHFDKNELVCLFDQIEPNPTTIRLVTPASTQKPKNWQAYRQRMIEPT
RISAGLRFWNQYETYLDWAEKKFGVPPHIIVGILGIESVYGNHTGNFRTIDTLATLAFDY
PETANQSVRKAFFRGELENLLLLSRENGTNPMNFYGSYAGAIGYPQFMPGSIRRYALDFD
GDGKIDLENSAIDAIGSIANFLLQHGWNEKQPIVFPVRKTPDCTMNETLLNQGLEARFTP
AQLKKECIVPDTNIPDGILYGLIDLPNGFADTEYWIGSDNFFAITHYNRSYFYAMSVILL
GEEILRKKDTDR

Enzyme Prediction     

No EC number prediction in MGYG000004063_01163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	69	364	4e-84	0.9627118644067797

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	1.73e-114	58	362	1	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02282	MltB	2.33e-114	64	364	1	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	7.50e-87	73	364	54	335	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	8.29e-86	66	366	63	355	murein hydrolase B; Provisional
TIGR02283	MltB_2	9.38e-59	89	364	32	298	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDX34016.1	1.09e-140	64	368	66	370
ARQ77449.1	1.09e-140	64	368	66	370
ARQ45141.1	1.09e-140	64	368	66	370
ASU37851.1	1.05e-122	66	364	79	376
AKZ61683.1	1.09e-120	65	364	72	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O8X_A	4.36e-68	64	368	9	303	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	7.20e-68	64	368	26	320	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	1.80e-64	66	364	22	314	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	1.90e-64	66	364	24	316	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5ANZ_A	7.07e-27	85	362	73	341	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	3.11e-63	66	364	63	355	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002109	0.306077	0.691051	0.000324	0.000206	0.000207

TMHMM  Annotations     

start	end
7	29