CAZyme Information: MGYG000004063_01619

Basic Information

• Species: Oxalobacter sp900760095
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter; Oxalobacter sp900760095
• CAZyme ID: MGYG000004063_01619
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
159	MGYG000004063_155|CGC1	17960.6	10.136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004063	2013916	MAG	United Kingdom	Europe

• Gene Location: Start: 50; End: 529 Strand: +

Full Sequence      

MKRAIIASEDANFTDHEGVDWDALLKAYEKNSRKGKIVAGGSTITQQLAKNLFLSGNRSY
FRKGQEIIITYMLEFWMEKERIFELYLNLVEFGTGVFGAEAAARHYYGTSASSLSAGQAA
RLAAMLPKPRYFDKHRNSGYLMHRTALILRRMGSADVPR

Enzyme Prediction     

No EC number prediction in MGYG000004063_01619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	1	152	2.5e-57	0.8531073446327684

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	6.93e-101	1	158	72	229	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.89e-83	1	158	67	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	2.76e-68	1	152	25	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.49e-63	1	157	88	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.68e-38	1	152	79	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDX33876.1	1.97e-98	1	159	81	239
ARQ77585.1	1.97e-98	1	159	81	239
ARQ45294.1	1.97e-98	1	159	81	239
QDZ28883.1	3.18e-86	1	158	74	231
AMO98673.1	6.41e-86	1	158	74	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.52e-32	4	152	35	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.40e-31	4	152	35	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.62e-25	4	152	54	202	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	5.92e-22	5	157	172	328	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	5.95e-22	5	157	193	349	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4G8N2	3.67e-86	1	158	74	231	Biosynthetic peptidoglycan transglycosylase OS=Herminiimonas arsenicoxydans OX=204773 GN=mtgA PE=3 SV=1
A6T2A4	9.95e-84	1	158	74	231	Biosynthetic peptidoglycan transglycosylase OS=Janthinobacterium sp. (strain Marseille) OX=375286 GN=mtgA PE=3 SV=1
Q7W039	5.01e-72	1	158	81	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=mtgA PE=3 SV=2
Q7WF82	5.01e-72	1	158	81	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=mtgA PE=3 SV=1
Q7W3V2	5.01e-72	1	158	81	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004063_01619.